SInCRe - Rv3461c

Tuberculist information

Gene name	rpmJ
Protein function	50S ribosomal protein L36 RpmJ
Functional category(tuberculist)	information pathways
Gene location(kb)	3880.29
Molecular mass(da)	4311.18
External sites	TB Database TubercuList WebTB

Protein sequence

Number of amino acids : 37

	  		  	1    VKVNPSVKPICDKCRLIRRHGRVMVICSDPRHKQRQG

Known structures in the PDB

No Known structures

Number of amino acids : 37

Domains assigned based on sequence.

Mtb Structural proteome models

CHOPIN models

Profile-based domain assignment

Structural/Functional domain family	Pfam acc.no./SCOP ID	Domain Region
Ribosomal_L36	PF00444	1-37

Mtb Structural Proteome models

Structure Models from Chopin

Binding pockets

STRING

Cytoscape Web will replace the contents of this div with protein-protein interaction network.

Protein interacting with Rv3461c	Gene name	Confidence Score
Rv3456c	rplQ	0.983
Rv0702	rplD	0.979
Rv0708	rplP	0.979
Rv0640	rplK	0.979
Rv0640	rplK	0.979
Rv3443c	rplM	0.978
Rv0714	rplN	0.977
Rv0720	rplR	0.974
Rv3460c	rpsM	0.972
Rv0709	rpmC	0.971
Rv0700	rpsJ	0.971
Rv0701	rplC	0.971
Rv3459c	rpsK	0.97
Rv0706	rplV	0.969
Rv0704	rplB	0.966
Rv0704	rplB	0.966
Rv0723	rplO	0.965
Rv0703	rplW	0.963
Rv0719	rplF	0.958
Rv3462c	infA	0.957
Rv0715	rplX	0.957
Rv0716	rplE	0.956
Rv0716	rplE	0.956
Rv2904c	rplS	0.955
Rv0652	rplL	0.948
Rv3924c	rpmH	0.945
Rv0685	tuf	0.94
Rv0685	tuf	0.94
Rv0685	tuf	0.94
Rv3457c	rpoA	0.936
Rv3457c	rpoA	0.936
Rv3457c	rpoA	0.936
Rv3458c	rpsD	0.935
Rv3458c	rpsD	0.935
Rv0717	rpsN1	0.931
Rv0722	rpmD	0.927
Rv0056	rplI	0.916
Rv0056	rplI	0.916
Rv2909c	rpsP	0.91
Rv1643	rplT	0.909
Rv0682	rpsL	0.907
Rv0721	rpsE	0.906
Rv0721	rpsE	0.906
Rv0707	rpsC	0.903
Rv0707	rpsC	0.903
Rv0641	rplA	0.902

Potential ligand/drug binding sites

No binding sites identified

Similarity to known drug target from sensitive sequence analysis

No drug targets

List of small molecules tested from TIBLE

Data not available

Off-target activity - ligand based from TIBLE

Data not available

Small molecules involved in protein-protein complex from TIMBAL .Proteins similar to Mtb based on sequence analysis.

Data not available

STITCH interactions