SInCRe - Rv3356c

Tuberculist information

Gene name	folD
Protein function	Probable bifunctional protein FolD: methylenetetrahydrofolate dehydrogenase + methenyltetrahydrofolate cyclohydrolase
Functional category(tuberculist)	intermediary metabolism and respiration
Gene location(kb)	3769.8
Molecular mass(da)	29451.7
External sites	TB Database TubercuList WebTB

Protein sequence

Number of amino acids : 281

	  		  	1    VGAIMLDGKATRDEIFGDLKQRVAALDAAGRTPGLGTILVGDDPGSQAYVRGKHADCAKV   60
			  	61   GITSIRRDLPADISTATLNETIDELNANPDCTGYIVQLPLPKHLDENAALERVDPAKDAD  120
			  	121  GLHPTNLGRLVLGTPAPLPCTPRGIVHLLRRYDISIAGAHVVVIGRGVTVGRPLGLLLTR  180
			  	181  RSENATVTLCHTGTRDLPALTRQADIVVAAVGVAHLLTADMVRPGAAVIDVGVSRTDDGL  240
			  	241  VGDVHPDVWELAGHVSPNPGGVGPLTRAFLLTNVVELAERR

Known structures in the PDB

	PDB ID	2C2X
	Total residue count	562
	Number of chains	2
	Method	X-RAY
	Resolution	2

	PDB ID	2C2Y
	Total residue count	281
	Number of chains	1
	Method	X-RAY
	Resolution	2.3

Number of amino acids : 281

Domains assigned based on sequence.

Mtb Structural proteome models

CHOPIN models

Profile-based domain assignment

Structural/Functional domain family	Pfam acc.no./SCOP ID	Domain Region
THF_DHG_CYH	PF00763	4-120
THF_DHG_CYH_C	PF02882	123-281

Mtb Structural Proteome models

Model Number	1
Model name	Rv3356c_2c2x_A
Template	2C2X APDB CREDO
Template coverage	2_281
Template Identity(%)	100.0
Model coverage(%)	99.3
Normalized DOPE score	-1.975

Model Number	2
Model name	Rv3356c
Template	2C2X APDB CREDO
Template coverage	2_281
Template Identity(%)	100.0
Model coverage(%)	99.3
Normalized DOPE score	-1.674

Structure Models from Chopin

Model Number	1
Profile	c.58.1.2 Click for model details
zscore	31.14
Residue begin	1
Residue end	147

Binding pockets

STRING

Cytoscape Web will replace the contents of this div with protein-protein interaction network.

Protein interacting with Rv3356c	Gene name	Confidence Score
Rv1093	glyA1	0.997
Rv0070c	glyA2	0.997
Rv0956	purN	0.997
Rv0957	purH	0.997
Rv0957	purH	0.997
Rv2964	purU	0.996
Rv2964	purU	0.996
Rv2211c	gcvT	0.994
Rv2211c	gcvT	0.994
Rv2764c	thyA	0.994
Rv1406	fmt	0.993
Rv1406	fmt	0.993
Rv3355c	Rv3355c	0.977
Rv3609c	folE	0.976
Rv1108c	xseA	0.972
Rv1108c	xseA	0.972
Rv2533c	nusB	0.969
Rv0389	purT	0.963
Rv2448c	valS	0.959
Rv2448c	valS	0.959
Rv2448c	valS	0.959
Rv2447c	folC	0.956
Rv2447c	folC	0.956
Rv0772	purD	0.955
Rv0772	purD	0.955
Rv0772	purD	0.955
Rv3276c	purK	0.954
Rv3275c	purE	0.949
Rv1599	hisD	0.948
Rv3411c	guaB2	0.942
Rv3411c	guaB2	0.942
Rv2445c	ndkA	0.939
Rv2754c	thyX	0.938
Rv3014c	ligA	0.935
Rv3014c	ligA	0.935
Rv3014c	ligA	0.935
Rv3014c	ligA	0.935
Rv3014c	ligA	0.935
Rv0500	proC	0.933
Rv0500	proC	0.933
Rv3674c	nth	0.928
Rv3674c	nth	0.928
Rv3674c	nth	0.928
Rv1696	recN	0.928
Rv2427c	proA	0.924
Rv3336c	trpS	0.921
Rv0952	sucD	0.916
Rv2763c	dfrA	0.916
Rv0952	sucD	0.916
Rv2404c	lepA	0.915
Rv2404c	lepA	0.915
Rv2404c	lepA	0.915
Rv2404c	lepA	0.915
Rv3359	Rv3359	0.914
Rv1617	pykA	0.911
Rv1617	pykA	0.911
Rv1832	gcvB	0.909
Rv1832	gcvB	0.909
Rv0951	sucC	0.908
Rv0951	sucC	0.908
Rv1023	eno	0.907
Rv0992c	Rv0992c	0.907
Rv1023	eno	0.907
Rv1694	tlyA	0.905
Rv1694	tlyA	0.905
Rv0809	purM	0.902
Rv0809	purM	0.902

Potential ligand/drug binding sites

Protein Model	Pocket Number	Drug Binding Site	PMIN Score	Pvalue PMIN	PMAX Score	Pvalue PMAX
Rv3356c_2c2x_A	2	3frq_ERY_B_195 PDB CREDO	0.631	0.144	0.631	0.001
Rv3356c_2c2x_A	2	3e22_LOC_B_700 PDB CREDO	0.626	0.149	0.626	0.001
Rv3356c_2c2x_A	2	3e22_LOC_D_700 PDB CREDO	0.626	0.149	0.626	0.001
Rv3356c_2c2x_A	2	3ut5_LOC_D_502 PDB CREDO	0.617	0.160	0.617	0.002
Rv3356c_2c2x_A	2	2hw2_RFP_A_1200 PDB CREDO	0.614	0.163	0.614	0.002
Rv3356c_2c2x_A	2	3h52_486_D_2 PDB CREDO	0.651	0.123	0.612	0.002
Rv3356c_2c2x_A	2	2oax_SNL_B_2001 PDB CREDO	0.606	0.172	0.606	0.002
Rv3356c_2c2x_A	2	2ab2_SNL_A_502 PDB CREDO	0.606	0.172	0.606	0.002
Rv3356c_2c2x_A	2	3h52_486_B_1 PDB CREDO	0.663	0.112	0.604	0.002
Rv3356c_2c2x_A	2	2ab2_SNL_B_503 PDB CREDO	0.603	0.176	0.603	0.002
Rv3356c_2c2x_A	2	2oax_SNL_C_3001 PDB CREDO	0.601	0.178	0.601	0.002
Rv3356c_2c2x_A	2	1fm6_BRL_X_504 PDB CREDO	0.620	0.156	0.600	0.002
Rv3356c_2c2x_A	2	3bbt_FMM_D_91 PDB CREDO	0.705	0.077	0.598	0.002
Rv3356c_2c2x_A	2	1zgy_BRL_A_503 PDB CREDO	0.677	0.099	0.595	0.002
Rv3356c_2c2x_A	2	2h42_VIA_A_901 PDB CREDO	0.700	0.081	0.594	0.002
Rv3356c_2c2x_A	2	3vhu_SNL_A_1001 PDB CREDO	0.593	0.188	0.593	0.002
Rv3356c_2c2x_A	11	1jg3_ADN_A_500 PDB CREDO	0.614	0.162	0.592	0.002
Rv3356c_2c2x_A	2	3h52_486_A_3 PDB CREDO	0.628	0.147	0.590	0.003
Rv3356c_2c2x_A	2	1z2b_VLB_C_800 PDB CREDO	0.646	0.128	0.589	0.003
Rv3356c_2c2x_A	2	3jwq_VIA_D_901 PDB CREDO	0.693	0.086	0.588	0.003
Rv3356c_2c2x_A	2	3ut5_LOC_B_502 PDB CREDO	0.625	0.150	0.587	0.003
Rv3356c_2c2x_A	2	3frq_ERY_A_195 PDB CREDO	0.684	0.094	0.587	0.003
Rv3356c_2c2x_A	2	1lhv_NOG_A_301 PDB CREDO	0.604	0.174	0.585	0.003
Rv3356c_2c2x_A	2	1uwh_BAX_A_1723 PDB CREDO	0.622	0.154	0.584	0.003
Rv3356c_2c2x_A	2	1uwh_BAX_B_1723 PDB CREDO	0.622	0.154	0.584	0.003
Rv3356c_2c2x_A	2	1sa1_POD_D_701 PDB CREDO	0.640	0.134	0.584	0.003
Rv3356c_2c2x_A	11	1jg3_ADN_B_550 PDB CREDO	0.630	0.145	0.584	0.003
Rv3356c_2c2x_A	2	1sa1_POD_B_700 PDB CREDO	0.654	0.120	0.579	0.003
Rv3356c_2c2x_A	11	1ie4_T44_B_328 PDB CREDO	0.621	0.154	0.576	0.003
Rv3356c_2c2x_A	2	2oax_SNL_F_6001 PDB CREDO	0.629	0.146	0.574	0.003
Rv3356c_2c2x_A	2	3d91_REM_B_350 PDB CREDO	0.648	0.126	0.574	0.003
Rv3356c_2c2x_A	2	2oax_SNL_D_4001 PDB CREDO	0.628	0.147	0.573	0.003
Rv3356c_2c2x_A	2	2oax_SNL_E_5001 PDB CREDO	0.628	0.147	0.573	0.003
Rv3356c_2c2x_A	2	2oax_SNL_A_1001 PDB CREDO	0.627	0.148	0.572	0.003
Rv3356c_2c2x_A	2	3mnp_DEX_A_784 PDB CREDO	0.590	0.191	0.572	0.003
Rv3356c_2c2x_A	2	2aa6_STR_A_401 PDB CREDO	0.630	0.145	0.571	0.004
Rv3356c_2c2x_A	2	3d91_REM_A_350 PDB CREDO	0.645	0.129	0.571	0.004
Rv3356c_2c2x_A	2	1a28_STR_B_2 PDB CREDO	0.589	0.192	0.571	0.004
Rv3356c_2c2x_A	2	1xzx_T3_X_500 PDB CREDO	0.589	0.193	0.570	0.004
Rv3356c_2c2x_A	2	2aa5_STR_A_301 PDB CREDO	0.627	0.148	0.569	0.004
Rv3356c_2c2x_A	11	2ito_IRE_A_2020 PDB CREDO	0.591	0.190	0.569	0.004
Rv3356c_2c2x_A	2	3mno_DEX_A_784 PDB CREDO	0.586	0.196	0.568	0.004
Rv3356c_2c2x_A	2	2aa6_STR_B_402 PDB CREDO	0.626	0.150	0.568	0.004
Rv3356c_2c2x_A	2	3vn2_TLS_A_501 PDB CREDO	0.586	0.196	0.568	0.004
Rv3356c_2c2x_A	2	1p93_DEX_D_4999 PDB CREDO	0.605	0.173	0.567	0.004
Rv3356c_2c2x_A	2	2aa5_STR_B_302 PDB CREDO	0.625	0.150	0.567	0.004
Rv3356c_2c2x_A	11	2ity_IRE_A_2020 PDB CREDO	0.637	0.138	0.567	0.004
Rv3356c_2c2x_A	2	2aax_PDN_B_503 PDB CREDO	0.625	0.151	0.567	0.004
Rv3356c_2c2x_A	2	3spk_TPV_A_100 PDB CREDO	0.646	0.129	0.567	0.004
Rv3356c_2c2x_A	11	3oht_1N1_A_1000 PDB CREDO	0.567	0.221	0.567	0.004
Rv3356c_2c2x_A	11	3n58_ADN_D_500 PDB CREDO	0.566	0.222	0.566	0.004
Rv3356c_2c2x_A	2	2aax_PDN_A_502 PDB CREDO	0.623	0.153	0.565	0.004
Rv3356c_2c2x_A	2	2nni_MTK_A_501 PDB CREDO	0.657	0.117	0.565	0.004
Rv3356c_2c2x_A	11	1d4f_ADN_B_602 PDB CREDO	0.565	0.224	0.565	0.004
Rv3356c_2c2x_A	11	1d4f_ADN_D_604 PDB CREDO	0.565	0.224	0.565	0.004
Rv3356c_2c2x_A	11	3ce6_ADN_B_500 PDB CREDO	0.565	0.224	0.565	0.004
Rv3356c_2c2x_A	2	3uvv_T3_A_501 PDB CREDO	0.583	0.200	0.564	0.004
Rv3356c_2c2x_A	2	3mne_DEX_A_784 PDB CREDO	0.601	0.177	0.564	0.004
Rv3356c_2c2x_A	2	3rif_IVM_A_403 PDB CREDO	0.738	0.054	0.564	0.004
Rv3356c_2c2x_A	11	3ce6_ADN_C_500 PDB CREDO	0.564	0.225	0.564	0.004
Rv3356c_2c2x_A	11	3ce6_ADN_A_500 PDB CREDO	0.563	0.226	0.563	0.004
Rv3356c_2c2x_A	11	3ce6_ADN_D_500 PDB CREDO	0.563	0.227	0.563	0.004
Rv3356c_2c2x_A	2	3gn8_DEX_B_247 PDB CREDO	0.598	0.182	0.561	0.004
Rv3356c_2c2x_A	2	3rif_IVM_A_402 PDB CREDO	0.733	0.058	0.560	0.004
Rv3356c_2c2x_A	2	3spk_TPV_B_100 PDB CREDO	0.651	0.123	0.560	0.004
Rv3356c_2c2x_A	2	1p93_DEX_C_3999 PDB CREDO	0.597	0.183	0.560	0.004
Rv3356c_2c2x_A	2	3gn8_DEX_A_247 PDB CREDO	0.597	0.183	0.560	0.004
Rv3356c_2c2x_A	2	3rif_IVM_D_402 PDB CREDO	0.732	0.059	0.559	0.004
Rv3356c_2c2x_A	2	1uwj_BAX_B_1723 PDB CREDO	0.631	0.143	0.559	0.004
Rv3356c_2c2x_A	2	3rif_IVM_B_403 PDB CREDO	0.731	0.059	0.559	0.004
Rv3356c_2c2x_A	11	2itz_IRE_A_2021 PDB CREDO	0.652	0.122	0.558	0.004
Rv3356c_2c2x_A	11	3g1u_ADN_C_438 PDB CREDO	0.558	0.232	0.558	0.004
Rv3356c_2c2x_A	2	1uwj_BAX_A_1723 PDB CREDO	0.688	0.090	0.558	0.004
Rv3356c_2c2x_A	2	1m2z_DEX_D_401 PDB CREDO	0.595	0.185	0.558	0.004
Rv3356c_2c2x_A	2	1bsx_T3_B_2 PDB CREDO	0.594	0.186	0.557	0.004
Rv3356c_2c2x_A	2	3tkd_CYZ_B_267 PDB CREDO	0.592	0.188	0.557	0.004
Rv3356c_2c2x_A	2	1bsx_T3_A_1 PDB CREDO	0.593	0.187	0.557	0.004
Rv3356c_2c2x_A	2	2y6o_1N1_A_1892 PDB CREDO	0.575	0.211	0.557	0.004
Rv3356c_2c2x_A	2	3ria_IVM_C_349 PDB CREDO	0.729	0.061	0.557	0.004
Rv3356c_2c2x_A	2	3tne_RIT_A_401 PDB CREDO	0.557	0.235	0.557	0.004
Rv3356c_2c2x_A	2	1xkk_FMM_A_91 PDB CREDO	0.829	0.015	0.556	0.004
Rv3356c_2c2x_A	2	1m2z_DEX_A_301 PDB CREDO	0.593	0.188	0.556	0.005
Rv3356c_2c2x_A	2	1nhz_486_A_800 PDB CREDO	0.632	0.143	0.555	0.005
Rv3356c_2c2x_A	2	3gws_T3_X_500 PDB CREDO	0.591	0.190	0.555	0.005
Rv3356c_2c2x_A	11	1ie4_T44_A_128 PDB CREDO	0.674	0.102	0.554	0.005
Rv3356c_2c2x_A	2	3ri5_IVM_C_350 PDB CREDO	0.725	0.063	0.554	0.005
Rv3356c_2c2x_A	2	2xkw_P1B_B_1475 PDB CREDO	0.725	0.063	0.554	0.005
Rv3356c_2c2x_A	2	3so9_017_A_100 PDB CREDO	0.589	0.193	0.553	0.005
Rv3356c_2c2x_A	11	1jg2_ADN_A_500 PDB CREDO	0.639	0.136	0.553	0.005
Rv3356c_2c2x_A	11	4e3a_ADN_B_500 PDB CREDO	0.553	0.240	0.553	0.005
Rv3356c_2c2x_A	2	3tkd_CYZ_A_266 PDB CREDO	0.553	0.240	0.553	0.005
Rv3356c_2c2x_A	2	1err_RAL_A_600 PDB CREDO	0.568	0.219	0.550	0.005
Rv3356c_2c2x_A	2	4asd_BAX_A_1500 PDB CREDO	0.622	0.154	0.550	0.005
Rv3356c_2c2x_A	2	2h79_T3_A_1 PDB CREDO	0.604	0.174	0.549	0.005
Rv3356c_2c2x_A	2	1err_RAL_B_600 PDB CREDO	0.564	0.225	0.547	0.005
Rv3356c_2c2x_A	2	2jfa_RAL_B_600 PDB CREDO	0.563	0.226	0.546	0.005
Rv3356c_2c2x_A	2	1jg2_ADN_A_500 PDB CREDO	0.665	0.110	0.545	0.005
Rv3356c_2c2x_A	2	2prg_BRL_A_1 PDB CREDO	0.689	0.090	0.545	0.005
Rv3356c_2c2x_A	2	1ya3_STR_B_2001 PDB CREDO	0.664	0.111	0.545	0.005
Rv3356c_2c2x_A	2	3oez_STI_B_601 PDB CREDO	0.544	0.252	0.544	0.006
Rv3356c_2c2x_A	2	1t46_STI_A_3 PDB CREDO	0.768	0.038	0.544	0.006
Rv3356c_2c2x_A	2	1ya3_STR_A_1001 PDB CREDO	0.662	0.113	0.543	0.006
Rv3356c_2c2x_A	2	1fm6_BRL_D_503 PDB CREDO	0.685	0.092	0.543	0.006
Rv3356c_2c2x_A	11	3g1u_ADN_D_438 PDB CREDO	0.562	0.228	0.541	0.006
Rv3356c_2c2x_A	2	2xpv_MIY_A_1209 PDB CREDO	0.681	0.096	0.539	0.006
Rv3356c_2c2x_A	2	1y0x_T44_X_500 PDB CREDO	0.573	0.212	0.539	0.006
Rv3356c_2c2x_A	11	3n58_ADN_A_500 PDB CREDO	0.601	0.178	0.539	0.006
Rv3356c_2c2x_A	11	1hwi_115_C_4 PDB CREDO	0.622	0.154	0.538	0.006
Rv3356c_2c2x_A	11	1d4f_ADN_C_603 PDB CREDO	0.600	0.179	0.538	0.006
Rv3356c_2c2x_A	11	3f4x_KLT_A_300 PDB CREDO	0.558	0.233	0.537	0.006
Rv3356c_2c2x_A	2	1p93_DEX_B_2999 PDB CREDO	0.632	0.142	0.537	0.006
Rv3356c_2c2x_A	2	1p93_DEX_A_1999 PDB CREDO	0.631	0.144	0.536	0.006
Rv3356c_2c2x_A	2	2w8y_486_A_1000 PDB CREDO	0.605	0.173	0.536	0.006
Rv3356c_2c2x_A	11	1hwi_115_A_2 PDB CREDO	0.683	0.094	0.534	0.006
Rv3356c_2c2x_A	2	1n49_RIT_D_401 PDB CREDO	0.637	0.137	0.532	0.007
Rv3356c_2c2x_A	11	2a69_RPT_C_8001 PDB CREDO	0.532	0.270	0.532	0.007
Rv3356c_2c2x_A	2	2oiq_STI_A_1001 PDB CREDO	0.582	0.201	0.531	0.007
Rv3356c_2c2x_A	2	3heg_BAX_A_1 PDB CREDO	0.582	0.201	0.531	0.007
Rv3356c_2c2x_A	2	2prg_BRL_B_2 PDB CREDO	0.669	0.107	0.529	0.007
Rv3356c_2c2x_A	11	3fuu_ADN_A_0 PDB CREDO	0.571	0.216	0.529	0.007
Rv3356c_2c2x_A	11	3g1u_ADN_B_438 PDB CREDO	0.593	0.188	0.528	0.007
Rv3356c_2c2x_A	2	2h77_T3_A_1 PDB CREDO	0.601	0.178	0.528	0.007
Rv3356c_2c2x_A	2	2jfa_RAL_A_600 PDB CREDO	0.528	0.276	0.528	0.007
Rv3356c_2c2x_A	11	3glq_RAB_A_602 PDB CREDO	0.592	0.188	0.528	0.007
Rv3356c_2c2x_A	11	3kw2_ADN_A_300 PDB CREDO	0.527	0.277	0.527	0.007
Rv3356c_2c2x_A	2	2h42_VIA_C_903 PDB CREDO	0.690	0.089	0.527	0.007
Rv3356c_2c2x_A	2	3b0w_DGX_A_1 PDB CREDO	0.594	0.187	0.525	0.007
Rv3356c_2c2x_A	11	1ict_T44_C_128 PDB CREDO	0.638	0.137	0.524	0.008
Rv3356c_2c2x_A	11	3n58_ADN_C_500 PDB CREDO	0.588	0.193	0.524	0.008
Rv3356c_2c2x_A	11	3glq_RAB_B_602 PDB CREDO	0.587	0.195	0.523	0.008
Rv3356c_2c2x_A	2	3rhw_IVM_A_348 PDB CREDO	0.764	0.040	0.522	0.008
Rv3356c_2c2x_A	2	3ri5_IVM_A_349 PDB CREDO	0.763	0.041	0.522	0.008
Rv3356c_2c2x_A	2	3ria_IVM_E_349 PDB CREDO	0.763	0.041	0.521	0.008
Rv3356c_2c2x_A	11	3g1u_ADN_A_438 PDB CREDO	0.585	0.197	0.521	0.008
Rv3356c_2c2x_A	2	2q1v_PDN_A_248 PDB CREDO	0.635	0.139	0.521	0.008
Rv3356c_2c2x_A	11	1v8b_ADN_C_2502 PDB CREDO	0.584	0.199	0.520	0.008
Rv3356c_2c2x_A	2	3qt0_486_A_4 PDB CREDO	0.613	0.164	0.520	0.008
Rv3356c_2c2x_A	11	3oht_1N1_B_1000 PDB CREDO	0.579	0.206	0.519	0.008
Rv3356c_2c2x_A	2	3jwq_VIA_B_901 PDB CREDO	0.679	0.098	0.518	0.008
Rv3356c_2c2x_A	2	1hwi_115_D_3 PDB CREDO	0.518	0.291	0.518	0.008
Rv3356c_2c2x_A	2	3h52_486_C_4 PDB CREDO	0.678	0.099	0.518	0.008
Rv3356c_2c2x_A	2	3bbt_FMM_B_91 PDB CREDO	0.757	0.044	0.517	0.008
Rv3356c_2c2x_A	2	3rif_IVM_E_402 PDB CREDO	0.757	0.044	0.517	0.008
Rv3356c_2c2x_A	11	1oq5_CEL_A_701 PDB CREDO	0.556	0.235	0.517	0.008
Rv3356c_2c2x_A	11	2c49_ADN_A_1301 PDB CREDO	0.557	0.234	0.516	0.008
Rv3356c_2c2x_A	2	3ri5_IVM_D_349 PDB CREDO	0.755	0.045	0.516	0.009
Rv3356c_2c2x_A	2	2pl0_STI_A_200 PDB CREDO	0.565	0.223	0.516	0.009
Rv3356c_2c2x_A	2	3ria_IVM_E_348 PDB CREDO	0.753	0.046	0.514	0.009
Rv3356c_2c2x_A	2	3rhw_IVM_D_348 PDB CREDO	0.752	0.047	0.514	0.009
Rv3356c_2c2x_A	2	3ria_IVM_A_348 PDB CREDO	0.752	0.047	0.514	0.009
Rv3356c_2c2x_A	11	3k54_1N1_A_1 PDB CREDO	0.533	0.268	0.514	0.009
Rv3356c_2c2x_A	2	1hwi_115_B_1 PDB CREDO	0.513	0.298	0.513	0.009
Rv3356c_2c2x_A	2	3h0a_9RA_A_500 PDB CREDO	0.605	0.173	0.513	0.009
Rv3356c_2c2x_A	2	3ria_IVM_C_350 PDB CREDO	0.751	0.047	0.513	0.009
Rv3356c_2c2x_A	11	1d4f_ADN_A_601 PDB CREDO	0.576	0.209	0.513	0.009
Rv3356c_2c2x_A	11	2xn7_T44_A_1355 PDB CREDO	0.599	0.180	0.513	0.009
Rv3356c_2c2x_A	2	3rhw_IVM_B_349 PDB CREDO	0.750	0.048	0.513	0.009
Rv3356c_2c2x_A	2	3rhw_IVM_D_349 PDB CREDO	0.750	0.048	0.513	0.009
Rv3356c_2c2x_A	2	3ri5_IVM_B_349 PDB CREDO	0.750	0.048	0.513	0.009
Rv3356c_2c2x_A	2	3rhw_IVM_B_348 PDB CREDO	0.750	0.048	0.512	0.009
Rv3356c_2c2x_A	2	3bjw_SVR_E_503 PDB CREDO	0.703	0.078	0.511	0.009
Rv3356c_2c2x_A	2	3gcs_BAX_A_401 PDB CREDO	0.577	0.207	0.511	0.009
Rv3356c_2c2x_A	2	1mx1_THA_C_3 PDB CREDO	0.645	0.129	0.511	0.009
Rv3356c_2c2x_A	2	3b0w_DGX_B_1 PDB CREDO	0.647	0.128	0.510	0.009
Rv3356c_2c2x_A	11	4eyb_0WO_A_303 PDB CREDO	0.569	0.218	0.510	0.009
Rv3356c_2c2x_A	11	3qlg_1N1_A_601 PDB CREDO	0.550	0.244	0.509	0.009
Rv3356c_2c2x_A	2	3ln1_CEL_A_682 PDB CREDO	0.543	0.254	0.509	0.009
Rv3356c_2c2x_A	11	3g5d_1N1_A_1 PDB CREDO	0.549	0.245	0.509	0.010
Rv3356c_2c2x_A	2	1jg3_ADN_A_500 PDB CREDO	0.690	0.088	0.508	0.010
Rv3356c_2c2x_A	2	3ln1_CEL_B_682 PDB CREDO	0.542	0.255	0.508	0.010
Rv3356c_2c2x_A	2	3ln1_CEL_C_682 PDB CREDO	0.542	0.255	0.508	0.010
Rv3356c_2c2x_A	2	2qxs_RAL_B_600 PDB CREDO	0.681	0.096	0.508	0.010
Rv3356c_2c2x_A	2	3sm2_478_A_126 PDB CREDO	0.797	0.026	0.508	0.010
Rv3356c_2c2x_A	2	2hyy_STI_B_600 PDB CREDO	0.556	0.236	0.507	0.010
Rv3356c_2c2x_A	2	3hec_STI_A_1 PDB CREDO	0.506	0.308	0.506	0.010
Rv3356c_2c2x_A	2	3ln1_CEL_D_682 PDB CREDO	0.596	0.184	0.506	0.010
Rv3356c_2c2x_A	11	3kp5_KAN_A_2001 PDB CREDO	0.616	0.161	0.506	0.010
Rv3356c_2c2x_A	11	3qlg_1N1_B_601 PDB CREDO	0.546	0.250	0.506	0.010
Rv3356c_2c2x_A	11	2xn6_T44_A_1370 PDB CREDO	0.590	0.191	0.505	0.010
Rv3356c_2c2x_A	11	3g5d_1N1_B_1 PDB CREDO	0.545	0.251	0.505	0.010
Rv3356c_2c2x_A	2	1ya3_STR_C_3001 PDB CREDO	0.684	0.093	0.504	0.010
Rv3356c_2c2x_A	11	3r9c_ECL_A_452 PDB CREDO	0.639	0.135	0.504	0.010
Rv3356c_2c2x_A	2	1qkn_RAL_A_600 PDB CREDO	0.536	0.264	0.503	0.010
Rv3356c_2c2x_A	2	2h42_VIA_B_902 PDB CREDO	0.658	0.116	0.503	0.010
Rv3356c_2c2x_A	2	1hwk_117_B_1 PDB CREDO	0.602	0.177	0.502	0.011
Rv3356c_2c2x_A	2	1uob_PNN_A_1311 PDB CREDO	0.551	0.243	0.502	0.011
Rv3356c_2c2x_A	2	2qxs_RAL_A_600 PDB CREDO	0.672	0.104	0.502	0.011
Rv3356c_2c2x_A	2	1s9p_DES_A_459 PDB CREDO	0.633	0.142	0.501	0.011

Similarity to known drug target from sensitive sequence analysis

No drug targets

List of small molecules tested from TIBLE

Data not available

Off-target activity - ligand based from TIBLE

Data not available

Small molecules involved in protein-protein complex from TIMBAL .Proteins similar to Mtb based on sequence analysis.

Data not available

STITCH interactions

Chemical Name	Confidence score	Molecular Weight
tetrahydrofolatePubChem	0.983	445.429
H4FPubChem	0.973	445.429
NAD+PubChem	0.973	663.425
phosphatePubChem	0.972	96.9872
10-formyltetrahydrofolatePubChem	0.964	473.439
5,10-methylenetetrahydrofolatePubChem	0.963	457.44
NADPPubChem	0.96	744.413
formatePubChem	0.956	45.0174
methenyltetrahydrofolatePubChem	0.95	456.432
methyltetrahydrofolatePubChem	0.939	459.456
5-methyltetrahydrofolatePubChem	0.93	459.456
N5,N10-methylenetetrahydrofolatePubChem	0.927	457.44
5,10-methenyltetrahydrofolatePubChem	0.911	456.432
carbon dioxidePubChem	0.91	44.0095
deuteriumPubChem	0.9	2.01588
ammoniaPubChem	0.9	17.0305
NSC333308PubChem	0.9	286.176
C09332PubChem	0.9	574.543
reduced nicotinamide adenine dinucleotidePubChem	0.9	665.441
formylglycinamide ribonucleotidePubChem	0.9	314.186
H(+)PubChem	0.9	2.01588
L-serinePubChem	0.9	105.093
10-formyltetrahydropteroylglutamic acidPubChem	0.9	473.439
NADP(H)PubChem	0.9	745.421
adenosine diphosphatePubChem	0.9	427.201
5'-phosphoribosyl-N-formylglycinamidePubChem	0.9	314.186
FGARPubChem	0.9	314.186
adenosine triphosphatePubChem	0.9	507.181
DL-serinePubChem	0.9	105.093
protiumPubChem	0.9	2.01576
glycinamide ribonucleotidePubChem	0.9	286.176
dihydronicotinamide formycin dinucleotidePubChem	0.9	665.441
polyglycinePubChem	0.9	75.0666
hydroxyl radicalsPubChem	0.9	17.0073
glycerolPubChem	0.793	92.0938
SeMetPubChem	0.707	196.106
selenomethioninePubChem	0.707	196.106
ethylene glycol; hydronPubChem	0.705	63.0758
polyethylene glycolPubChem	0.705	62.0678
hydride acetatePubChem	0.705	61.0599
imidazolePubChem	0.705	68.0773
hydron diphosphatePubChem	0.705	391.981
acetatePubChem	0.705	59.044