SInCRe - Rv3674c

Tuberculist information

Gene name	nth
Protein function	Probable endonuclease III Nth (DNA-(apurinic or apyrimidinic site)lyase) (AP lyase) (AP endonuclease class I) (endodeoxyribonuclease (apurinic or apyrimidinic)) (deoxyribonuclease (apurinic or apyrimidinic))
Functional category(tuberculist)	information pathways
Gene location(kb)	4115.16
Molecular mass(da)	26998.3
External sites	TB Database TubercuList WebTB

Protein sequence

Number of amino acids : 245

	  		  	1    VPGRWSAETRLALVRRARRMNRALAQAFPHVYCELDFTTPLELAVATILSAQSTDKRVNL   60
			  	61   TTPALFARYRTARDYAQADRTELESLIRPTGFYRNKAASLIGLGQALVERFGGEVPATMD  120
			  	121  KLVTLPGVGRKTANVILGNAFGIPGITVDTHFGRLVRRWRWTTAEDPVKVEQAVGELIER  180
			  	181  KEWTLLSHRVIFHGRRVCHARRPACGVCVLAKDCPSFGLGPTEPLLAAPLVQGPETDHLL  240
			  	241  ALAGL

Known structures in the PDB

No Known structures

Number of amino acids : 245

Domains assigned based on sequence.

Mtb Structural proteome models

CHOPIN models

Profile-based domain assignment

Structural/Functional domain family	Pfam acc.no./SCOP ID	Domain Region
HhH-GPD	PF00730	45-180
HHH	PF00633	110-139
EndIII_4Fe-2S	PF10576	198-214

Mtb Structural Proteome models

Model Number	1
Model name	Rv3674c
Template	1ORN APDB CREDO
Template coverage	5_206
Template Identity(%)	43.3
Model coverage(%)	81.6
Normalized DOPE score	-1.141

Structure Models from Chopin

Model Number	1
Profile	a.96.1.1 Click for model details
zscore	47.16
Residue begin	11
Residue end	225

Binding pockets

STRING

Cytoscape Web will replace the contents of this div with protein-protein interaction network.

Protein interacting with Rv3674c	Gene name	Confidence Score
Rv0670	end	0.989
Rv2924c	fpg	0.963
Rv2924c	fpg	0.963
Rv2976c	ung	0.963
Rv2924c	fpg	0.963
Rv1420	uvrC	0.958
Rv1420	uvrC	0.958
Rv1420	uvrC	0.958
Rv1420	uvrC	0.958
Rv1023	eno	0.954
Rv1023	eno	0.954
Rv1633	uvrB	0.943
Rv1633	uvrB	0.943
Rv1633	uvrB	0.943
Rv1633	uvrB	0.943
Rv0427c	xthA	0.941
Rv1020	mfd	0.94
Rv1020	mfd	0.94
Rv1020	mfd	0.94
Rv1020	mfd	0.94
Rv2448c	valS	0.937
Rv2448c	valS	0.937
Rv2448c	valS	0.937
Rv2362c	recO	0.933
Rv2362c	recO	0.933
Rv3356c	folD	0.928
Rv3356c	folD	0.928
Rv1649	pheS	0.927
Rv1649	pheS	0.927
Rv2973c	recG	0.918
Rv2973c	recG	0.918
Rv2973c	recG	0.918
Rv2925c	rnc	0.917
Rv2925c	rnc	0.917
Rv2439c	proB	0.913
Rv2439c	proB	0.913
Rv0006	gyrA	0.906
Rv0006	gyrA	0.906

Potential ligand/drug binding sites

No binding sites identified

Similarity to known drug target from sensitive sequence analysis

No drug targets

List of small molecules tested from TIBLE

Data not available

Off-target activity - ligand based from TIBLE

Data not available

Small molecules involved in protein-protein complex from TIMBAL .Proteins similar to Mtb based on sequence analysis.

Data not available

STITCH interactions

Chemical Name	Confidence score	Molecular Weight
dihydrouracilPubChem	0.986	114.103
formamidopyrimidinePubChem	0.975	123.113
thymine glycolPubChem	0.906	160.128
5-hydroxycytosinePubChem	0.895	127.101
5-hydroxyuracilPubChem	0.895	128.086
8-oxoGPubChem	0.843	299.24
thyminePubChem	0.828	126.113
cytosinePubChem	0.804	111.102
8-oxoguaninePubChem	0.789	167.126
berberinePubChem	0.755	336.361
uracilPubChem	0.755	112.087
cyclobutanePubChem	0.71	56.1063
guaninePubChem	0.708	151.126
pyrimidine ringPubChem	0.704	80.088
dihydrothyminePubChem	0.703	128.129