SInCRe - Rv1420

Tuberculist information

Gene name	uvrC
Protein function	Probable excinuclease ABC (subunit C - nuclease) UvrC
Functional category(tuberculist)	information pathways
Gene location(kb)	1594.04
Molecular mass(da)	71582.1
External sites	TB Database TubercuList WebTB

Protein sequence

Number of amino acids : 646

	  		  	1    VPDPATYRPAPGSIPVEPGVYRFRDQHGRVIYVGKAKSLRSRLTSYFADVASLAPRTRQL   60
			  	61   VTTAAKVEWTVVGTEVEALQLEYTWIKEFDPRFNVRYRDDKSYPVLAVTLGEEFPRLMVY  120
			  	121  RGPRRKGVRYFGPYSHAWAIRETLDLLTRVFPARTCSAGVFKRHRQIDRPCLLGYIDKCS  180
			  	181  APCIGRVDAAQHRQIVADFCDFLSGKTDRFARALEQQMNAAAEQLDFERAARLRDDLSAL  240
			  	241  KRAMEKQAVVLGDGTDADVVAFADDELEAAVQVFHVRGGRVRGQRGWIVEKPGEPGDSGI  300
			  	301  QLVEQFLTQFYGDQAALDDAADESANPVPREVLVPCLPSNAEELASWLSGLRGSRVVLRV  360
			  	361  PRRGDKRALAETVHRNAEDALQQHKLKRASDFNARSAALQSIQDSLGLADAPLRIECVDV  420
			  	421  SHVQGTDVVGSLVVFEDGLPRKSDYRHFGIREAAGQGRSDDVACIAEVTRRRFLRHLRDQ  480
			  	481  SDPDLLSPERKSRRFAYPPNLYVVDGGAPQVNAASAVIDELGVTDVAVIGLAKRLEEVWV  540
			  	541  PSEPDPIIMPRNSEGLYLLQRVRDEAHRFAITYHRSKRSTRMTASALDSVPGLGEHRRKA  600
			  	601  LVTHFGSIARLKEATVDEITAVPGIGVATATAVHDALRPDSSGAAR

Known structures in the PDB

No Known structures

Number of amino acids : 646

Domains assigned based on sequence.

Mtb Structural proteome models

CHOPIN models

Profile-based domain assignment

Structural/Functional domain family	Pfam acc.no./SCOP ID	Domain Region
GIY-YIG	PF01541	17-94
UVR	PF02151	208-243
UvrC_HhH_N	PF08459	402-571
HHH_2	PF12826	585-642

Mtb Structural Proteome models

Model Number	1
Model name	Rv1420.4
Template	2A1J BPDB CREDO
Template coverage	239_292
Template Identity(%)	27.8
Model coverage(%)	8.2
Normalized DOPE score	-1.974

Model Number	2
Model name	Rv1420
Template	1YD6 APDB CREDO
Template coverage	3_95
Template Identity(%)	41.9
Model coverage(%)	14.6
Normalized DOPE score	-1.528

Model Number	3
Model name	Rv1420.3
Template	2BGW APDB CREDO
Template coverage	168_224
Template Identity(%)	31.6
Model coverage(%)	8.7
Normalized DOPE score	-1.506

Model Number	4
Model name	Rv1420.2
Template	2D7D BPDB CREDO
Template coverage	622_659
Template Identity(%)	44.7
Model coverage(%)	5.7
Normalized DOPE score	-1.284

Structure Models from Chopin

Model Number	1
Profile	a.60.2.5 Click for model details
zscore	16.36
Residue begin	566
Residue end	646

Model Number	2
Profile	d.226.1.1 - 3.40.1440.10 Click for model details
zscore	12.88
Residue begin	16
Residue end	104

Model Number	3
Profile	a.2.9.1 - 4.10.860.10 Click for model details
zscore	10.58
Residue begin	202
Residue end	248

Binding pockets

STRING

Cytoscape Web will replace the contents of this div with protein-protein interaction network.

Protein interacting with Rv1420	Gene name	Confidence Score
Rv1633	uvrB	0.999
Rv1633	uvrB	0.999
Rv1633	uvrB	0.999
Rv1633	uvrB	0.999
Rv1638	uvrA	0.997
Rv1421	Rv1421	0.962
Rv3674c	nth	0.958
Rv3674c	nth	0.958
Rv3674c	nth	0.958
Rv1696	recN	0.955
Rv2592c	ruvB	0.95
Rv2592c	ruvB	0.95
Rv2746c	pgsA3	0.945
Rv1020	mfd	0.942
Rv1020	mfd	0.942
Rv1020	mfd	0.942
Rv1020	mfd	0.942
Rv1423	whiA	0.939
Rv1423	whiA	0.939
Rv1423	whiA	0.939
Rv1422	Rv1422	0.937
Rv3715c	recR	0.933
Rv3715c	recR	0.933
Rv3715c	recR	0.933
Rv0002	dnaN	0.929
Rv0002	dnaN	0.929
Rv0002	dnaN	0.929
Rv0054	ssb	0.927
Rv2720	lexA	0.927
Rv2720	lexA	0.927
Rv0949	uvrD1	0.926
Rv0949	uvrD1	0.926
Rv3913	trxB2	0.921
Rv2593c	ruvA	0.921
Rv3913	trxB2	0.921
Rv2593c	ruvA	0.921
Rv2593c	ruvA	0.921
Rv1699	pyrG	0.916
Rv3198c	uvrD2	0.916
Rv3198c	uvrD2	0.916
Rv3198c	uvrD2	0.916
Rv1699	pyrG	0.916
Rv3589	mutY	0.911
Rv3589	mutY	0.911
Rv3846	sodA	0.91
Rv3846	sodA	0.91
Rv0629c	recD	0.907
Rv0629c	recD	0.907
Rv0670	end	0.906
Rv1436	gap	0.904
Rv1436	gap	0.904
Rv1316c	ogt	0.903
Rv1316c	ogt	0.903

Potential ligand/drug binding sites

Protein Model	Pocket Number	Drug Binding Site	PMIN Score	Pvalue PMIN	PMAX Score	Pvalue PMAX
Rv1420.4	2	3lfa_1N1_A_361 PDB CREDO	0.755	0.045	0.662	0.001
Rv1420.4	2	3hm1_J3Z_A_2 PDB CREDO	0.659	0.116	0.629	0.001
Rv1420.3	2	3hgx_SAL_B_104 PDB CREDO	0.662	0.113	0.626	0.001
Rv1420.3	2	3ret_SAL_B_201 PDB CREDO	0.660	0.115	0.625	0.001
Rv1420.4	2	1sn0_T44_C_601 PDB CREDO	0.623	0.152	0.623	0.001
Rv1420.4	2	1pcg_EST_B_2 PDB CREDO	0.647	0.127	0.618	0.001
Rv1420.4	2	3ads_IMN_B_3 PDB CREDO	0.671	0.105	0.614	0.002
Rv1420.4	2	1ere_EST_B_600 PDB CREDO	0.642	0.133	0.613	0.002
Rv1420.4	2	1ere_EST_E_600 PDB CREDO	0.642	0.133	0.613	0.002
Rv1420.4	2	1ere_EST_A_600 PDB CREDO	0.638	0.136	0.610	0.002
Rv1420.4	2	1g50_EST_B_1600 PDB CREDO	0.636	0.138	0.608	0.002
Rv1420.4	2	1gwr_EST_B_600 PDB CREDO	0.635	0.139	0.607	0.002
Rv1420.4	2	1qku_EST_A_600 PDB CREDO	0.634	0.140	0.606	0.002
Rv1420.4	2	1qku_EST_C_600 PDB CREDO	0.634	0.140	0.606	0.002
Rv1420.4	2	1qku_EST_B_600 PDB CREDO	0.633	0.142	0.605	0.002
Rv1420.3	2	3ret_SAL_A_201 PDB CREDO	0.638	0.136	0.604	0.002
Rv1420.4	2	1ere_EST_F_600 PDB CREDO	0.659	0.116	0.603	0.002
Rv1420.4	2	1gwr_EST_A_600 PDB CREDO	0.631	0.144	0.603	0.002
Rv1420.4	2	2j7x_EST_A_1454 PDB CREDO	0.657	0.118	0.601	0.002
Rv1420.4	2	3oll_EST_A_600 PDB CREDO	0.657	0.118	0.601	0.002
Rv1420.4	2	3oll_EST_B_600 PDB CREDO	0.657	0.118	0.601	0.002
Rv1420.3	2	3hgx_SAL_A_102 PDB CREDO	0.635	0.140	0.601	0.002
Rv1420.4	2	1a52_EST_A_1 PDB CREDO	0.656	0.119	0.600	0.002
Rv1420.4	2	1ere_EST_C_600 PDB CREDO	0.656	0.119	0.600	0.002
Rv1420.4	2	1ere_EST_D_600 PDB CREDO	0.656	0.119	0.600	0.002
Rv1420.4	2	1pcg_EST_A_1 PDB CREDO	0.656	0.119	0.600	0.002
Rv1420.4	2	3hm1_J3Z_B_1 PDB CREDO	0.656	0.119	0.600	0.002
Rv1420.4	2	1g50_EST_C_2600 PDB CREDO	0.655	0.120	0.599	0.002
Rv1420.4	2	2ocf_EST_A_596 PDB CREDO	0.655	0.120	0.599	0.002
Rv1420.4	2	1qkt_EST_A_600 PDB CREDO	0.654	0.121	0.599	0.002
Rv1420.4	2	1a52_EST_B_2 PDB CREDO	0.653	0.122	0.598	0.002
Rv1420.4	2	1uay_ADN_A_1001 PDB CREDO	0.625	0.151	0.597	0.002
Rv1420.4	2	3ug2_IRE_A_1 PDB CREDO	0.713	0.071	0.591	0.002
Rv1420.4	2	1sn5_T3_D_602 PDB CREDO	0.590	0.191	0.590	0.003
Rv1420.4	2	1g50_EST_A_600 PDB CREDO	0.727	0.061	0.588	0.003
Rv1420.4	2	2yja_EST_B_1550 PDB CREDO	0.727	0.061	0.588	0.003
Rv1420.4	2	3ols_EST_A_600 PDB CREDO	0.725	0.063	0.586	0.003
Rv1420.4	2	2uxp_CLM_A_1211 PDB CREDO	0.612	0.165	0.585	0.003
Rv1420.4	2	3ols_EST_B_600 PDB CREDO	0.723	0.064	0.584	0.003
Rv1420.4	2	2uxp_CLM_B_1211 PDB CREDO	0.611	0.166	0.584	0.003
Rv1420.4	2	3uud_EST_A_600 PDB CREDO	0.721	0.066	0.583	0.003
Rv1420.4	2	3uud_EST_B_600 PDB CREDO	0.718	0.068	0.580	0.003
Rv1420.3	2	3rem_SAL_B_301 PDB CREDO	0.717	0.068	0.579	0.003
Rv1420.4	2	2y7j_B49_D_1294 PDB CREDO	0.575	0.211	0.575	0.003
Rv1420.4	2	4dta_ADN_A_401 PDB CREDO	0.575	0.211	0.575	0.003
Rv1420.4	2	1sn5_T3_C_601 PDB CREDO	0.654	0.121	0.574	0.003
Rv1420.4	2	1xbb_STI_A_1 PDB CREDO	0.689	0.089	0.571	0.004
Rv1420.4	2	2zva_1N1_A_513 PDB CREDO	0.729	0.060	0.566	0.004
Rv1420.4	2	2y7j_B49_A_1294 PDB CREDO	0.591	0.190	0.565	0.004
Rv1420.4	2	1r9o_FLP_A_501 PDB CREDO	0.586	0.197	0.560	0.004
Rv1420.3	2	3rem_SAL_A_301 PDB CREDO	0.692	0.087	0.559	0.004
Rv1420.4	2	1cqp_803_A_311 PDB CREDO	0.579	0.205	0.554	0.005
Rv1420.4	2	1s9p_DES_C_500 PDB CREDO	0.711	0.072	0.552	0.005
Rv1420.3	2	1g50_EST_B_1600 PDB CREDO	0.824	0.017	0.549	0.005
Rv1420.3	2	1qku_EST_C_600 PDB CREDO	0.824	0.017	0.549	0.005
Rv1420.3	2	1qku_EST_A_600 PDB CREDO	0.822	0.017	0.548	0.005
Rv1420.3	2	1qku_EST_B_600 PDB CREDO	0.821	0.018	0.547	0.005
Rv1420.4	2	3qlg_1N1_B_601 PDB CREDO	0.730	0.059	0.545	0.005
Rv1420.4	2	1s9p_DES_B_459 PDB CREDO	0.702	0.079	0.545	0.005
Rv1420.4	2	1mx1_THA_A_1 PDB CREDO	0.620	0.156	0.544	0.005
Rv1420.4	2	3g5d_1N1_A_1 PDB CREDO	0.727	0.061	0.543	0.006
Rv1420.3	2	1ere_EST_E_600 PDB CREDO	0.814	0.020	0.542	0.006
Rv1420.4	2	3adx_IMN_B_3 PDB CREDO	0.669	0.107	0.540	0.006
Rv1420.3	2	1ere_EST_A_600 PDB CREDO	0.811	0.021	0.540	0.006
Rv1420.4	2	1mx1_THA_B_2 PDB CREDO	0.641	0.133	0.540	0.006
Rv1420.3	2	1ere_EST_B_600 PDB CREDO	0.810	0.021	0.539	0.006
Rv1420.3	2	1pcg_EST_B_2 PDB CREDO	0.810	0.021	0.539	0.006
Rv1420.4	2	3g5d_1N1_B_1 PDB CREDO	0.720	0.066	0.538	0.006
Rv1420.4	2	3oht_1N1_A_1000 PDB CREDO	0.777	0.034	0.537	0.006
Rv1420.3	2	1gwr_EST_A_600 PDB CREDO	0.806	0.022	0.537	0.006
Rv1420.4	2	3qlg_1N1_A_601 PDB CREDO	0.719	0.067	0.537	0.006
Rv1420.4	2	3r9c_ECL_A_452 PDB CREDO	0.611	0.166	0.536	0.006
Rv1420.4	2	2uxo_TAC_B_1211 PDB CREDO	0.661	0.114	0.534	0.006
Rv1420.3	2	1gwr_EST_B_600 PDB CREDO	0.800	0.025	0.533	0.007
Rv1420.4	2	1pg2_ADN_A_552 PDB CREDO	0.584	0.199	0.532	0.007
Rv1420.4	2	2fum_MIX_B_1539 PDB CREDO	0.655	0.120	0.529	0.007
Rv1420.4	2	2itz_IRE_A_2021 PDB CREDO	0.644	0.130	0.521	0.008
Rv1420.4	2	2ity_IRE_A_2020 PDB CREDO	0.669	0.107	0.519	0.008
Rv1420.4	2	1ie4_T44_A_128 PDB CREDO	0.612	0.165	0.515	0.009
Rv1420.4	2	1m17_AQ4_A_999 PDB CREDO	0.612	0.165	0.515	0.009
Rv1420.4	2	3rem_SAL_B_301 PDB CREDO	0.654	0.121	0.515	0.009
Rv1420.4	2	2ito_IRE_A_2020 PDB CREDO	0.716	0.069	0.515	0.009
Rv1420.4	2	1mx1_THA_D_4 PDB CREDO	0.661	0.114	0.513	0.009
Rv1420.4	2	1cqp_803_B_311 PDB CREDO	0.536	0.264	0.512	0.009
Rv1420.4	2	1mx1_THA_F_6 PDB CREDO	0.659	0.116	0.511	0.009
Rv1420.4	2	1qhy_CLM_A_999 PDB CREDO	0.617	0.159	0.511	0.009
Rv1420.4	2	3bbt_FMM_B_91 PDB CREDO	0.708	0.075	0.509	0.010
Rv1420.3	2	1a52_EST_B_2 PDB CREDO	0.871	0.006	0.508	0.010
Rv1420.3	2	1g50_EST_C_2600 PDB CREDO	0.870	0.007	0.507	0.010
Rv1420.4	2	3oht_1N1_B_1000 PDB CREDO	0.817	0.019	0.507	0.010
Rv1420.3	2	1a52_EST_A_1 PDB CREDO	0.868	0.007	0.506	0.010
Rv1420.3	2	2bxe_1FL_B_2003 PDB CREDO	0.625	0.150	0.505	0.010
Rv1420.3	2	3hm1_J3Z_B_1 PDB CREDO	0.867	0.007	0.505	0.010
Rv1420.3	2	2ocf_EST_A_596 PDB CREDO	0.865	0.008	0.504	0.010
Rv1420.3	2	1ere_EST_C_600 PDB CREDO	0.862	0.008	0.502	0.011
Rv1420.3	2	1ere_EST_D_600 PDB CREDO	0.862	0.008	0.502	0.011
Rv1420.3	2	1ere_EST_F_600 PDB CREDO	0.860	0.008	0.501	0.011
Rv1420.3	2	1qkt_EST_A_600 PDB CREDO	0.860	0.008	0.501	0.011
Rv1420.3	2	2j7x_EST_A_1454 PDB CREDO	0.860	0.008	0.501	0.011
Rv1420.4	2	3rem_SAL_A_301 PDB CREDO	0.636	0.139	0.501	0.011

Similarity to known drug target from sensitive sequence analysis

No drug targets

List of small molecules tested from TIBLE

Data not available

Off-target activity - ligand based from TIBLE

Data not available

Small molecules involved in protein-protein complex from TIMBAL .Proteins similar to Mtb based on sequence analysis.

Data not available

STITCH interactions

Chemical Name	Confidence score	Molecular Weight
Lys-Phe-His-Glu-Lys-His-His-Ser-His-Arg-Gly-TyrPubChem	0.738	1562.69
mitomycin CPubChem	0.7	334.327