SInCRe - Rv0629c

Tuberculist information

Gene name	recD
Protein function	Probable exonuclease V (alpha chain) RecD (exodeoxyribonuclease V alpha chain) (exodeoxyribonuclease V polypeptide)
Functional category(tuberculist)	information pathways
Gene location(kb)	720.005
Molecular mass(da)	61714.7
External sites	TB Database TubercuList WebTB

Protein sequence

Number of amino acids : 575

	  		  	1    VKLTDVDFAVEASGMVRAFNQAGVLDVSDVHVAQRLCALAGESDERVALAVAVAVRALRA   60
			  	61   GSVCVDLLSIARVAGHDDLPWPDPADWLAAVRASPLLADPPVLHLYDDRLLYLDRYWREE  120
			  	121  EQVCADLLALLTSRRPAGVPDLRRLFPTGFDEQRRAAEIALSQGVTVLTGGPGTGKTTTV  180
			  	181  ARLLALVAEQAELAGEPRPRIALAAPTGKAAARLAEAVRREMAKLDATDRARLGDLHAVT  240
			  	241  LHRLLGAKPGARFRQDRQNRLPHNVIVVDETSMVSLTLMARLAEAVRPGARLILVGDADQ  300
			  	301  LASVEAGAVLADLVDGFSVRDDALVAQLRTSHRFGKVIGTLAEAIRAGDGDAVLGLLRSG  360
			  	361  EERIEFVDDEDPAPRLRAVLVPHALRLREAALLGASDVALATLDEHRLLCAHRDGPTGVL  420
			  	421  HWNRRVQAWLAEETGQPPWTPWYAGRPLLVTANDYGLRVYNGDTGVVLAGPTGLRAVISG  480
			  	481  ASGPLDVATGRLGDVETMHAMTIHKSQGSQVDEVTVLMPQEDSRLLTRELLYTAVTRAKR  540
			  	541  KVRVVGSEASVRAAIARRAVRASGLRMRLQSTGCG

Known structures in the PDB

No Known structures

Number of amino acids : 575

Domains assigned based on sequence.

Mtb Structural proteome models

CHOPIN models

Profile-based domain assignment

Structural/Functional domain family	Pfam acc.no./SCOP ID	Domain Region
AAA_30	PF13604	150-369
UvrD_C_2	PF13538	442-545

Mtb Structural Proteome models

Model Number	1
Model name	Rv0629c
Template	1W36 DPDB CREDO
Template coverage	27_600
Template Identity(%)	38.3
Model coverage(%)	91.5
Normalized DOPE score	0.857

Model Number	2
Model name	Rv0629c.1
Template	1W36 DPDB CREDO
Template coverage	2_606
Template Identity(%)	29.6
Model coverage(%)	98.1
Normalized DOPE score	1.01

Structure Models from Chopin

Model Number	1
Profile	c.37.1.14 Click for model details
zscore	12.27
Residue begin	153
Residue end	299

Model Number	2
Profile	c.37.1.23 Click for model details
zscore	9.52
Residue begin	34
Residue end	312

Binding pockets

STRING

Cytoscape Web will replace the contents of this div with protein-protein interaction network.

Protein interacting with Rv0629c	Gene name	Confidence Score
Rv0630c	recB	0.999
Rv0630c	recB	0.999
Rv0630c	recB	0.999
Rv0631c	recC	0.999
Rv3715c	recR	0.961
Rv3715c	recR	0.961
Rv3715c	recR	0.961
Rv2592c	ruvB	0.957
Rv2592c	ruvB	0.957
Rv2593c	ruvA	0.954
Rv2593c	ruvA	0.954
Rv2593c	ruvA	0.954
Rv2594c	ruvC	0.948
Rv0003	recF	0.929
Rv3198c	uvrD2	0.911
Rv3198c	uvrD2	0.911
Rv3198c	uvrD2	0.911
Rv1696	recN	0.908
Rv1420	uvrC	0.907
Rv1420	uvrC	0.907
Rv1420	uvrC	0.907
Rv1420	uvrC	0.907
Rv1633	uvrB	0.906
Rv1633	uvrB	0.906
Rv1633	uvrB	0.906
Rv1633	uvrB	0.906

Potential ligand/drug binding sites

Protein Model	Pocket Number	Drug Binding Site	PMIN Score	Pvalue PMIN	PMAX Score	Pvalue PMAX
Rv0629c.1	7	1d4f_ADN_C_603 PDB CREDO	0.614	0.162	0.593	0.002
Rv0629c.1	3	1xkk_FMM_A_91 PDB CREDO	0.716	0.069	0.575	0.003
Rv0629c.1	7	1d4f_ADN_D_604 PDB CREDO	0.613	0.164	0.569	0.004
Rv0629c.1	7	1d4f_ADN_B_602 PDB CREDO	0.609	0.169	0.566	0.004
Rv0629c.1	7	1hwi_115_C_4 PDB CREDO	0.598	0.181	0.557	0.004
Rv0629c.1	7	3g1u_ADN_C_438 PDB CREDO	0.596	0.184	0.554	0.005
Rv0629c.1	3	3gp0_NIL_A_1 PDB CREDO	0.707	0.075	0.553	0.005
Rv0629c.1	7	3ce6_ADN_C_500 PDB CREDO	0.593	0.187	0.551	0.005
Rv0629c.1	7	3n58_ADN_A_500 PDB CREDO	0.570	0.217	0.550	0.005
Rv0629c.1	7	3ce6_ADN_B_500 PDB CREDO	0.590	0.191	0.548	0.005
Rv0629c.1	7	3ce6_ADN_D_500 PDB CREDO	0.590	0.191	0.548	0.005
Rv0629c.1	3	1k6c_MK1_B_902 PDB CREDO	0.574	0.211	0.548	0.005
Rv0629c.1	7	3ce6_ADN_A_500 PDB CREDO	0.585	0.198	0.544	0.006
Rv0629c.1	3	3ucb_017_A_201 PDB CREDO	0.580	0.203	0.541	0.006
Rv0629c.1	7	3n58_ADN_D_500 PDB CREDO	0.581	0.202	0.540	0.006
Rv0629c.1	3	2pym_1UN_A_1001 PDB CREDO	0.620	0.155	0.537	0.006
Rv0629c.1	3	2q64_1UN_B_1001 PDB CREDO	0.620	0.155	0.537	0.006
Rv0629c.1	3	2qak_1UN_A_1001 PDB CREDO	0.620	0.155	0.537	0.006
Rv0629c.1	3	2pyn_1UN_A_1001 PDB CREDO	0.619	0.157	0.536	0.006
Rv0629c.1	3	1c6z_ROC_B_505 PDB CREDO	0.618	0.158	0.535	0.006
Rv0629c.1	3	2q63_1UN_A_1001 PDB CREDO	0.616	0.160	0.534	0.006
Rv0629c.1	3	1t7i_017_A_200 PDB CREDO	0.555	0.236	0.530	0.007
Rv0629c.1	7	1hwi_115_A_2 PDB CREDO	0.629	0.146	0.530	0.007
Rv0629c.1	3	1rl8_RIT_A_9001 PDB CREDO	0.595	0.185	0.528	0.007
Rv0629c.1	7	3glq_RAB_A_602 PDB CREDO	0.624	0.152	0.516	0.009
Rv0629c.1	7	1d4f_ADN_A_601 PDB CREDO	0.620	0.155	0.514	0.009
Rv0629c.1	7	3g1u_ADN_D_438 PDB CREDO	0.573	0.212	0.513	0.009
Rv0629c.1	7	2a69_RPT_C_8001 PDB CREDO	0.551	0.242	0.512	0.009
Rv0629c.1	7	3glq_RAB_B_602 PDB CREDO	0.618	0.158	0.512	0.009
Rv0629c.1	3	3cyx_ROC_A_201 PDB CREDO	0.521	0.286	0.509	0.009
Rv0629c.1	7	3n58_ADN_C_500 PDB CREDO	0.613	0.164	0.507	0.010
Rv0629c.1	7	2a68_RBT_M_8002 PDB CREDO	0.544	0.252	0.506	0.010
Rv0629c.1	7	1v8b_ADN_C_2502 PDB CREDO	0.607	0.171	0.503	0.010
Rv0629c.1	3	3tkg_ROC_C_901 PDB CREDO	0.503	0.314	0.503	0.010
Rv0629c.1	3	3el4_ROC_A_100 PDB CREDO	0.526	0.279	0.502	0.011
Rv0629c.1	7	1hwi_115_D_3 PDB CREDO	0.655	0.119	0.500	0.011
Rv0629c.1	3	1t46_STI_A_3 PDB CREDO	0.656	0.118	0.500	0.011

Similarity to known drug target from sensitive sequence analysis

No drug targets

List of small molecules tested from TIBLE

Data not available

Off-target activity - ligand based from TIBLE

Data not available

Small molecules involved in protein-protein complex from TIMBAL .Proteins similar to Mtb based on sequence analysis.

Data not available

STITCH interactions

No high confidence interactions