SInCRe - Rv3198c

Tuberculist information

Gene name	uvrD2
Protein function	Probable ATP-dependent DNA helicase II UvrD2
Functional category(tuberculist)	information pathways
Gene location(kb)	3569.11
Molecular mass(da)	75603.7
External sites	TB Database TubercuList WebTB

Protein sequence

Number of amino acids : 700

	  		  	1    MSIASDPLIAGLDDQQREAVLAPRGPVCVLAGAGTGKTRTITHRIASLVASGHVAAGQVL   60
			  	61   AVTFTQRAAGEMRSRLRALDAAARTGSGVGAVQALTFHAAAYRQLRYFWSRVIADTGWQL  120
			  	121  LDSKFAVVARAASRTRLHASTDDVRDLAGEIEWAKASLIGPEEYVTAVAAARRDPPLDAA  180
			  	181  QIAAVYSEYEALKARGDGVTLLDFDDLLLHTAAAIENDAAVAEEFQDRYRCFVVDEYQDV  240
			  	241  TPLQQRVLSAWLGDRDDLTVVGDANQTIYSFTGASPRFLLDFSRRFPDAAVVRLERDYRS  300
			  	301  TPQVVSLANRVIAAARGRVAGSKLRLSGQREPGPVPSFHEHSDEPAEAATVAASIARLIA  360
			  	361  SGTPPSEVAILYRVNAQSEVYEEALTQAGIAYQVRGGEGFFNRQEIKQALLALQRVSERD  420
			  	421  TDAALSDVVRAVLAPLGLTAQPPVGTRARERWEALTALAELVDDELAQRPALQLPGLLAE  480
			  	481  LRRRAEARHPPVVQGVTLASLHAAKGLEWDAVFLVGLADGTLPISHALAHGPNSEPVEEE  540
			  	541  RRLLYVGITRARVHLALSWALSRSPGGRQSRKPSRFLNGIAPQTRADPVPGTSRRNRGAA  600
			  	601  ARCRICNNELNTSAAVMLRRCETCAADVDEELLLQLKSWRLSTAKEQNVPAYVVFTDNTL  660
			  	661  IAIAELLPTDDAALIAIPGIGARKLEQYGSDVLQLVRGRT

Known structures in the PDB

No Known structures

Number of amino acids : 700

Domains assigned based on sequence.

Mtb Structural proteome models

CHOPIN models

Profile-based domain assignment

Structural/Functional domain family	Pfam acc.no./SCOP ID	Domain Region
UvrD-helicase	PF00580	12-287
UvrD_C	PF13361	292-442
UvrD_C	PF13361	445-562
HRDC	PF00570	629-696

Mtb Structural Proteome models

Model Number	1
Model name	Rv3198c.3
Template	1WUD APDB CREDO
Template coverage	530_602
Template Identity(%)	41.1
Model coverage(%)	10.3
Normalized DOPE score	-1.889

Model Number	2
Model name	Rv3198c
Template	1PJR APDB CREDO
Template coverage	1_648
Template Identity(%)	33.6
Model coverage(%)	83.7
Normalized DOPE score	0.149

Model Number	3
Model name	Rv3198c.2
Template	1W36 BPDB CREDO
Template coverage	5_961
Template Identity(%)	19.4
Model coverage(%)	97.7
Normalized DOPE score	1.589

Structure Models from Chopin

Model Number	1
Profile	a.60.8.1 - 1.10.150.80 Click for model details
zscore	18.04
Residue begin	629
Residue end	696

Binding pockets

STRING

Cytoscape Web will replace the contents of this div with protein-protein interaction network.

Protein interacting with Rv3198c	Gene name	Confidence Score
Rv1638	uvrA	0.926
Rv1633	uvrB	0.923
Rv1633	uvrB	0.923
Rv1633	uvrB	0.923
Rv1633	uvrB	0.923
Rv1420	uvrC	0.916
Rv1420	uvrC	0.916
Rv1420	uvrC	0.916
Rv1420	uvrC	0.916
Rv2592c	ruvB	0.912
Rv2592c	ruvB	0.912
Rv0629c	recD	0.911
Rv0629c	recD	0.911

Potential ligand/drug binding sites

Protein Model	Pocket Number	Drug Binding Site	PMIN Score	Pvalue PMIN	PMAX Score	Pvalue PMAX
Rv3198c.2	16	2xpv_MIY_A_1209 PDB CREDO	0.708	0.075	0.683	0.000
Rv3198c.2	16	2vke_TAC_A_222 PDB CREDO	0.750	0.048	0.645	0.001
Rv3198c.2	16	2xpw_OTC_A_222 PDB CREDO	0.747	0.050	0.643	0.001
Rv3198c.2	16	2trt_TAC_A_222 PDB CREDO	0.772	0.036	0.614	0.002
Rv3198c.2	16	2o7o_DXT_A_222 PDB CREDO	0.771	0.037	0.613	0.002
Rv3198c.2	16	1ict_T44_D_129 PDB CREDO	0.716	0.069	0.593	0.002
Rv3198c.2	16	3f4x_KLT_A_300 PDB CREDO	0.644	0.130	0.577	0.003
Rv3198c.2	16	3q1e_T44_C_128 PDB CREDO	0.644	0.130	0.577	0.003
Rv3198c.2	16	1ynn_RFP_C_1120 PDB CREDO	0.574	0.211	0.574	0.003
Rv3198c.3	2	2xn5_FUN_A_1356 PDB CREDO	0.590	0.191	0.567	0.004
Rv3198c.2	16	1hwi_115_C_4 PDB CREDO	0.608	0.169	0.567	0.004
Rv3198c.2	16	1hwi_115_A_2 PDB CREDO	0.673	0.103	0.567	0.004
Rv3198c.3	2	3aod_RFP_C_2002 PDB CREDO	0.654	0.120	0.562	0.004
Rv3198c.2	16	2xn5_FUN_A_1356 PDB CREDO	0.705	0.077	0.561	0.004
Rv3198c.3	2	3sxr_1N1_A_1 PDB CREDO	0.560	0.230	0.560	0.004
Rv3198c.2	16	3frq_ERY_B_195 PDB CREDO	0.731	0.059	0.559	0.004
Rv3198c.3	2	1uho_VDN_A_1000 PDB CREDO	0.629	0.146	0.557	0.004
Rv3198c.3	2	3sxr_1N1_B_2 PDB CREDO	0.576	0.208	0.554	0.005
Rv3198c.3	2	2h42_VIA_B_902 PDB CREDO	0.667	0.108	0.553	0.005
Rv3198c.3	2	2o7o_DXT_A_222 PDB CREDO	0.575	0.211	0.552	0.005
Rv3198c.2	16	1oq5_CEL_A_701 PDB CREDO	0.552	0.241	0.552	0.005
Rv3198c.3	2	2trt_TAC_A_222 PDB CREDO	0.574	0.212	0.551	0.005
Rv3198c.2	16	1cil_ETS_A_263 PDB CREDO	0.610	0.167	0.549	0.005
Rv3198c.3	2	1jip_KTN_A_801 PDB CREDO	0.595	0.185	0.549	0.005
Rv3198c.2	16	3n58_ADN_A_500 PDB CREDO	0.567	0.221	0.547	0.005
Rv3198c.3	2	3jwq_VIA_B_901 PDB CREDO	0.660	0.114	0.547	0.005
Rv3198c.3	2	2w8y_NDR_B_1000 PDB CREDO	0.547	0.249	0.547	0.005
Rv3198c.3	2	1jin_KTN_A_801 PDB CREDO	0.545	0.251	0.545	0.005
Rv3198c.2	16	2xrl_DXT_A_1211 PDB CREDO	0.775	0.035	0.544	0.006
Rv3198c.3	2	3ls4_TCI_H_220 PDB CREDO	0.544	0.253	0.544	0.006
Rv3198c.3	2	2h42_VIA_C_903 PDB CREDO	0.656	0.119	0.543	0.006
Rv3198c.2	16	3jwq_VIA_B_901 PDB CREDO	0.542	0.255	0.542	0.006
Rv3198c.3	2	1udu_CIA_B_2003 PDB CREDO	0.638	0.136	0.541	0.006
Rv3198c.2	16	2a69_RPT_C_8001 PDB CREDO	0.580	0.204	0.539	0.006
Rv3198c.3	2	2vke_TAC_A_222 PDB CREDO	0.558	0.232	0.537	0.006
Rv3198c.2	16	1zgf_TRU_A_300 PDB CREDO	0.599	0.180	0.536	0.006
Rv3198c.2	16	1hwi_115_D_3 PDB CREDO	0.701	0.080	0.536	0.006
Rv3198c.2	16	1hwi_115_B_1 PDB CREDO	0.700	0.081	0.535	0.006
Rv3198c.2	16	2pou_I7A_A_1000 PDB CREDO	0.597	0.182	0.534	0.006
Rv3198c.3	2	3jwq_VIA_D_901 PDB CREDO	0.714	0.071	0.532	0.007
Rv3198c.2	16	3bl1_BL1_A_300 PDB CREDO	0.594	0.186	0.532	0.007
Rv3198c.3	2	2xpw_OTC_A_222 PDB CREDO	0.551	0.242	0.530	0.007
Rv3198c.3	2	1a27_EST_A_350 PDB CREDO	0.551	0.243	0.529	0.007
Rv3198c.2	16	1i2w_CFX_B_2300 PDB CREDO	0.665	0.110	0.529	0.007
Rv3198c.2	16	3aod_RFP_C_2002 PDB CREDO	0.549	0.246	0.529	0.007
Rv3198c.2	16	1fm6_BRL_D_503 PDB CREDO	0.548	0.247	0.529	0.007
Rv3198c.2	16	2prg_BRL_A_1 PDB CREDO	0.547	0.248	0.528	0.007
Rv3198c.2	16	1i2w_CFX_A_1300 PDB CREDO	0.664	0.111	0.528	0.007
Rv3198c.3	2	3adx_IMN_A_2 PDB CREDO	0.638	0.137	0.528	0.007
Rv3198c.3	2	2xn7_T44_A_1355 PDB CREDO	0.545	0.251	0.524	0.008
Rv3198c.3	2	1ya3_STR_C_3001 PDB CREDO	0.609	0.169	0.523	0.008
Rv3198c.3	2	1z9h_IMN_C_379 PDB CREDO	0.615	0.161	0.522	0.008
Rv3198c.3	2	2ayl_FLP_B_2701 PDB CREDO	0.565	0.223	0.522	0.008
Rv3198c.3	2	3k2h_LYA_A_514 PDB CREDO	0.542	0.255	0.521	0.008
Rv3198c.2	16	3k2h_LYA_B_514 PDB CREDO	0.539	0.260	0.520	0.008
Rv3198c.2	16	3ut5_LOC_D_502 PDB CREDO	0.681	0.097	0.520	0.008
Rv3198c.3	2	2ayl_FLP_A_1701 PDB CREDO	0.540	0.258	0.520	0.008
Rv3198c.2	16	3cs8_BRL_A_503 PDB CREDO	0.627	0.148	0.519	0.008
Rv3198c.3	2	1z9h_IMN_D_476 PDB CREDO	0.612	0.164	0.519	0.008
Rv3198c.2	16	1fr6_AZR_A_362 PDB CREDO	0.580	0.204	0.519	0.008
Rv3198c.2	16	4eyb_0WO_A_303 PDB CREDO	0.538	0.262	0.519	0.008
Rv3198c.3	2	1z9h_IMN_A_379 PDB CREDO	0.611	0.166	0.518	0.008
Rv3198c.3	2	1z9h_IMN_B_381 PDB CREDO	0.611	0.166	0.518	0.008
Rv3198c.3	2	2xrl_DXT_A_1211 PDB CREDO	0.611	0.167	0.518	0.008
Rv3198c.3	2	2xn6_T44_A_1370 PDB CREDO	0.538	0.261	0.517	0.008
Rv3198c.3	2	3kw2_ADN_B_300 PDB CREDO	0.517	0.292	0.517	0.008
Rv3198c.2	16	1fr6_AZR_B_362 PDB CREDO	0.577	0.208	0.516	0.009
Rv3198c.3	2	3h52_486_C_4 PDB CREDO	0.624	0.152	0.516	0.009
Rv3198c.2	16	3jwq_VIA_D_901 PDB CREDO	0.573	0.212	0.516	0.009
Rv3198c.2	16	1hwl_FBI_B_1 PDB CREDO	0.740	0.053	0.516	0.009
Rv3198c.2	16	1hwl_FBI_D_3 PDB CREDO	0.740	0.053	0.516	0.009
Rv3198c.3	2	1udt_VIA_A_1000 PDB CREDO	0.664	0.111	0.515	0.009
Rv3198c.2	16	1z9y_FUN_A_500 PDB CREDO	0.575	0.210	0.515	0.009
Rv3198c.2	16	3frq_ERY_A_195 PDB CREDO	0.782	0.032	0.514	0.009
Rv3198c.3	2	3ads_IMN_A_2 PDB CREDO	0.666	0.109	0.514	0.009
Rv3198c.3	2	2prg_BRL_B_2 PDB CREDO	0.642	0.132	0.513	0.009
Rv3198c.3	2	2iyf_ERY_A_1400 PDB CREDO	0.534	0.267	0.513	0.009
Rv3198c.2	16	2a69_RPT_M_8002 PDB CREDO	0.589	0.192	0.512	0.009
Rv3198c.2	16	1hwl_FBI_C_4 PDB CREDO	0.734	0.057	0.512	0.009
Rv3198c.2	16	3q1e_T44_D_328 PDB CREDO	0.728	0.061	0.511	0.009
Rv3198c.2	16	1ict_T44_C_128 PDB CREDO	0.668	0.107	0.510	0.009
Rv3198c.2	16	3sv8_SV6_A_1 PDB CREDO	0.668	0.107	0.510	0.009
Rv3198c.3	2	2bxg_IBP_B_2001 PDB CREDO	0.601	0.177	0.510	0.009
Rv3198c.2	16	1hwl_FBI_A_2 PDB CREDO	0.732	0.059	0.510	0.009
Rv3198c.2	16	3g1u_ADN_B_438 PDB CREDO	0.615	0.162	0.509	0.009
Rv3198c.3	2	2h42_VIA_A_901 PDB CREDO	0.683	0.094	0.509	0.009
Rv3198c.3	2	2uxo_TAC_B_1211 PDB CREDO	0.530	0.273	0.509	0.009
Rv3198c.3	2	1fm6_BRL_D_503 PDB CREDO	0.637	0.138	0.509	0.010
Rv3198c.2	16	1hwk_117_D_3 PDB CREDO	0.708	0.074	0.509	0.010
Rv3198c.3	2	3cs8_BRL_A_503 PDB CREDO	0.507	0.307	0.507	0.010
Rv3198c.2	16	2xn7_T44_A_1355 PDB CREDO	0.638	0.137	0.507	0.010
Rv3198c.3	2	1ict_T44_D_129 PDB CREDO	0.507	0.308	0.507	0.010
Rv3198c.3	2	3n8z_FLP_B_1701 PDB CREDO	0.527	0.277	0.507	0.010
Rv3198c.2	16	3ce6_ADN_C_500 PDB CREDO	0.544	0.252	0.506	0.010
Rv3198c.2	16	3g1u_ADN_A_438 PDB CREDO	0.611	0.166	0.506	0.010
Rv3198c.2	16	3hku_TOR_A_300 PDB CREDO	0.525	0.281	0.506	0.010
Rv3198c.3	2	1z9y_FUN_A_500 PDB CREDO	0.547	0.249	0.506	0.010
Rv3198c.3	2	3f4x_KLT_A_300 PDB CREDO	0.547	0.249	0.506	0.010
Rv3198c.3	2	1a28_STR_A_1 PDB CREDO	0.633	0.142	0.506	0.010
Rv3198c.3	2	2prg_BRL_A_1 PDB CREDO	0.633	0.142	0.506	0.010
Rv3198c.2	16	3ce6_ADN_B_500 PDB CREDO	0.544	0.253	0.505	0.010
Rv3198c.2	16	3n58_ADN_D_500 PDB CREDO	0.544	0.253	0.505	0.010
Rv3198c.2	16	3sv9_SV6_A_1 PDB CREDO	0.565	0.224	0.505	0.010
Rv3198c.2	16	4eyb_0WO_B_301 PDB CREDO	0.524	0.282	0.505	0.010
Rv3198c.3	2	1ya3_STR_B_2001 PDB CREDO	0.655	0.120	0.505	0.010
Rv3198c.2	16	3e22_LOC_D_700 PDB CREDO	0.661	0.114	0.505	0.010
Rv3198c.2	16	2h79_T3_A_1 PDB CREDO	0.600	0.179	0.505	0.010
Rv3198c.2	16	3ce6_ADN_A_500 PDB CREDO	0.543	0.254	0.505	0.010
Rv3198c.2	16	3e22_LOC_B_700 PDB CREDO	0.660	0.114	0.504	0.010
Rv3198c.2	16	3tkd_CYZ_A_266 PDB CREDO	0.660	0.115	0.504	0.010
Rv3198c.2	16	2xkw_P1B_B_1475 PDB CREDO	0.504	0.312	0.504	0.010
Rv3198c.3	2	2q1v_PDN_A_248 PDB CREDO	0.653	0.122	0.503	0.010
Rv3198c.2	16	2xn6_T44_A_1370 PDB CREDO	0.633	0.142	0.503	0.010
Rv3198c.2	16	3ce6_ADN_D_500 PDB CREDO	0.542	0.256	0.503	0.010
Rv3198c.3	2	3nt1_NPS_A_5 PDB CREDO	0.523	0.283	0.503	0.010
Rv3198c.3	2	2xpv_MIY_A_1209 PDB CREDO	0.628	0.147	0.502	0.011
Rv3198c.2	16	1ya3_STR_B_2001 PDB CREDO	0.538	0.261	0.502	0.011
Rv3198c.2	16	1ya3_STR_C_3001 PDB CREDO	0.520	0.288	0.501	0.011
Rv3198c.2	16	3h52_486_C_4 PDB CREDO	0.501	0.316	0.501	0.011
Rv3198c.3	2	3sv8_SV6_A_1 PDB CREDO	0.543	0.253	0.501	0.011
Rv3198c.3	2	1kvl_CLS_A_371 PDB CREDO	0.644	0.130	0.500	0.011
Rv3198c.3	2	2ydo_ADN_A_400 PDB CREDO	0.616	0.160	0.500	0.011
Rv3198c.3	2	3nt1_NPS_B_4 PDB CREDO	0.521	0.286	0.500	0.011
Rv3198c.2	16	3ut5_LOC_B_502 PDB CREDO	0.697	0.083	0.500	0.011

Similarity to known drug target from sensitive sequence analysis

No drug targets

List of small molecules tested from TIBLE

Data not available

Off-target activity - ligand based from TIBLE

Data not available

Small molecules involved in protein-protein complex from TIMBAL .Proteins similar to Mtb based on sequence analysis.

Data not available

STITCH interactions

No high confidence interactions