SInCRe - Rv0949

Tuberculist information

Gene name	uvrD1
Protein function	Probable ATP-dependent DNA helicase II UvrD1
Functional category(tuberculist)	information pathways
Gene location(kb)	1058.26
Molecular mass(da)	85049.9
External sites	TB Database TubercuList WebTB

Protein sequence

Number of amino acids : 771

	  		  	1    MSVHATDAKPPGPSPADQLLDGLNPQQRQAVVHEGSPLLIVAGAGSGKTAVLTRRIAYLM   60
			  	61   AARGVGVGQILAITFTNKAAAEMRERVVGLVGEKARYMWVSTFHSTCVRILRNQAALIEG  120
			  	121  LNSNFSIYDADDSRRLLQMVGRDLGLDIKRYSPRLLANAISNLKNELIDPHQALAGLTED  180
			  	181  SDDLARAVASVYDEYQRRLRAANALDFDDLIGETVAVLQAFPQIAQYYRRRFRHVLVDEY  240
			  	241  QDTNHAQYVLVRELVGRDSNDGIPPGELCVVGDADQSIYAFRGATIRNIEDFERDYPDTR  300
			  	301  TILLEQNYRSTQNILSAANSVIARNAGRREKRLWTDAGAGELIVGYVADNEHDEARFVAE  360
			  	361  EIDALAEGSEITYNDVAVFYRTNNSSRSLEEVLIRAGIPYKVVGGVRFYERKEIRDIVAY  420
			  	421  LRVLDNPGDAVSLRRILNTPRRGIGDRAEACVAVYAENTGVGFGDALVAAAQGKVPMLNT  480
			  	481  RAEKAIAGFVEMFDELRGRLDDDLGELVEAVLERTGYRRELEASTDPQELARLDNLNELV  540
			  	541  SVAHEFSTDRENAAALGPDDEDVPDTGVLADFLERVSLVADADEIPEHGAGVVTLMTLHT  600
			  	601  AKGLEFPVVFVTGWEDGMFPHMRALDNPTELSEERRLAYVGITRARQRLYVSRAIVRSSW  660
			  	661  GQPMLNPESRFLREIPQELIDWRRTAPKPSFSAPVSGAGRFGSARPSPTRSGASRRPLLV  720
			  	721  LQVGDRVTHDKYGLGRVEEVSGVGESAMSLIDFGSSGRVKLMHNHAPVTKL

Known structures in the PDB

No Known structures

Number of amino acids : 771

Domains assigned based on sequence.

Mtb Structural proteome models

CHOPIN models

Profile-based domain assignment

Structural/Functional domain family	Pfam acc.no./SCOP ID	Domain Region
UvrD-helicase	PF00580	23-297
UvrD_C	PF13361	302-656

Mtb Structural Proteome models

Model Number	1
Model name	Rv0949
Template	1PJR APDB CREDO
Template coverage	5_647
Template Identity(%)	50.7
Model coverage(%)	86.3
Normalized DOPE score	-0.416

Model Number	2
Model name	Rv0949.2
Template	1W36 BPDB CREDO
Template coverage	5_934
Template Identity(%)	19.1
Model coverage(%)	96.8
Normalized DOPE score	1.292

Structure Models from Chopin

Model Number	1
Profile	1.10.10.160, 1.10.486.10, 3.40.50.300 Click for model details
zscore	93.54
Residue begin	14
Residue end	693

Model Number	2
Profile	1.10.486.10 Click for model details
zscore	25.91
Residue begin	402
Residue end	580

Model Number	3
Profile	1.10.10.160 Click for model details
zscore	17.85
Residue begin	127
Residue end	207

Binding pockets

STRING

Cytoscape Web will replace the contents of this div with protein-protein interaction network.

Protein interacting with Rv0949	Gene name	Confidence Score
Rv1638	uvrA	0.987
Rv1633	uvrB	0.978
Rv1633	uvrB	0.978
Rv1633	uvrB	0.978
Rv1633	uvrB	0.978
Rv3014c	ligA	0.968
Rv3014c	ligA	0.968
Rv3014c	ligA	0.968
Rv3014c	ligA	0.968
Rv3014c	ligA	0.968
Rv2973c	recG	0.951
Rv2973c	recG	0.951
Rv2973c	recG	0.951
Rv1341	Rv1341	0.945
Rv1420	uvrC	0.926
Rv1420	uvrC	0.926
Rv1420	uvrC	0.926
Rv1420	uvrC	0.926
Rv2592c	ruvB	0.917
Rv2592c	ruvB	0.917
Rv2737c	recA	0.905
Rv2737c	recA	0.905

Potential ligand/drug binding sites

Protein Model	Pocket Number	Drug Binding Site	PMIN Score	Pvalue PMIN	PMAX Score	Pvalue PMAX
Rv0949.2	27	3ria_IVM_A_348 PDB CREDO	0.667	0.108	0.642	0.001
Rv0949.2	27	3rhw_IVM_B_348 PDB CREDO	0.665	0.110	0.640	0.001
Rv0949.2	27	3ri5_IVM_D_349 PDB CREDO	0.665	0.110	0.640	0.001
Rv0949.2	27	3ria_IVM_C_350 PDB CREDO	0.665	0.110	0.640	0.001
Rv0949.2	27	3ria_IVM_E_348 PDB CREDO	0.665	0.110	0.640	0.001
Rv0949.2	27	3rhw_IVM_D_348 PDB CREDO	0.664	0.111	0.639	0.001
Rv0949.2	27	3rhw_IVM_D_349 PDB CREDO	0.664	0.111	0.639	0.001
Rv0949.2	27	3rif_IVM_E_402 PDB CREDO	0.663	0.112	0.639	0.001
Rv0949.2	27	3rhw_IVM_B_349 PDB CREDO	0.662	0.113	0.637	0.001
Rv0949.2	27	3ri5_IVM_B_349 PDB CREDO	0.662	0.113	0.637	0.001
Rv0949.2	27	3ria_IVM_E_349 PDB CREDO	0.654	0.121	0.630	0.001
Rv0949.2	27	3rhw_IVM_A_348 PDB CREDO	0.652	0.122	0.628	0.001
Rv0949.2	27	3ri5_IVM_A_349 PDB CREDO	0.652	0.123	0.628	0.001
Rv0949.2	27	1ya3_STR_C_3001 PDB CREDO	0.646	0.128	0.623	0.001
Rv0949.2	27	3rif_IVM_A_402 PDB CREDO	0.665	0.110	0.618	0.001
Rv0949.2	27	3ria_IVM_C_349 PDB CREDO	0.665	0.111	0.618	0.002
Rv0949.2	27	3rif_IVM_D_402 PDB CREDO	0.664	0.111	0.617	0.002
Rv0949.2	27	3rif_IVM_B_403 PDB CREDO	0.660	0.115	0.613	0.002
Rv0949.2	27	3ri5_IVM_C_350 PDB CREDO	0.658	0.117	0.611	0.002
Rv0949.2	27	3h52_486_C_4 PDB CREDO	0.656	0.118	0.610	0.002
Rv0949.2	27	2h42_VIA_C_903 PDB CREDO	0.654	0.120	0.608	0.002
Rv0949.2	27	3rif_IVM_A_403 PDB CREDO	0.654	0.120	0.608	0.002
Rv0949.2	27	3bbt_FMM_B_91 PDB CREDO	0.629	0.146	0.606	0.002
Rv0949.2	27	2h42_VIA_B_902 PDB CREDO	0.651	0.123	0.605	0.002
Rv0949.2	27	3ri5_IVM_E_349 PDB CREDO	0.678	0.099	0.604	0.002
Rv0949.2	27	3sxr_1N1_A_1 PDB CREDO	0.678	0.099	0.604	0.002
Rv0949.2	27	3jwq_VIA_B_901 PDB CREDO	0.642	0.132	0.597	0.002
Rv0949.2	27	3k54_1N1_A_1 PDB CREDO	0.619	0.157	0.597	0.002
Rv0949.2	27	3sxr_1N1_B_2 PDB CREDO	0.695	0.085	0.595	0.002
Rv0949.2	27	1ya3_STR_B_2001 PDB CREDO	0.685	0.093	0.593	0.002
Rv0949.2	27	1ya3_STR_A_1001 PDB CREDO	0.683	0.095	0.591	0.002
Rv0949.2	27	1a28_STR_A_1 PDB CREDO	0.659	0.116	0.591	0.002
Rv0949.2	27	2q1v_PDN_A_248 PDB CREDO	0.679	0.098	0.588	0.003
Rv0949.2	27	3aod_RFP_C_2002 PDB CREDO	0.608	0.170	0.586	0.003
Rv0949.2	27	2h42_VIA_A_901 PDB CREDO	0.695	0.085	0.581	0.003
Rv0949.2	26	1v8b_ADN_C_2502 PDB CREDO	0.601	0.178	0.578	0.003
Rv0949.2	27	3jwq_VIA_D_901 PDB CREDO	0.690	0.088	0.577	0.003
Rv0949.2	27	1lhu_EST_A_301 PDB CREDO	0.644	0.131	0.577	0.003
Rv0949.2	27	1mx1_THA_C_3 PDB CREDO	0.644	0.131	0.577	0.003
Rv0949.2	27	1jg3_ADN_A_500 PDB CREDO	0.598	0.181	0.576	0.003
Rv0949.2	27	1p93_DEX_A_1999 PDB CREDO	0.689	0.089	0.576	0.003
Rv0949.2	27	1p93_DEX_B_2999 PDB CREDO	0.688	0.090	0.576	0.003
Rv0949.2	27	2uxo_TAC_B_1211 PDB CREDO	0.669	0.106	0.573	0.003
Rv0949.2	27	3adx_IMN_B_3 PDB CREDO	0.668	0.108	0.572	0.003
Rv0949.2	27	2prg_BRL_B_2 PDB CREDO	0.637	0.137	0.571	0.004
Rv0949.2	27	2prg_BRL_A_1 PDB CREDO	0.637	0.138	0.571	0.004
Rv0949.2	26	3fuu_ADN_A_0 PDB CREDO	0.570	0.217	0.570	0.004
Rv0949.2	27	1a27_EST_A_350 PDB CREDO	0.612	0.165	0.567	0.004
Rv0949.2	27	1fm6_BRL_D_503 PDB CREDO	0.632	0.143	0.566	0.004
Rv0949.2	27	2ito_IRE_A_2020 PDB CREDO	0.587	0.195	0.565	0.004
Rv0949.2	27	3bbt_FMM_D_91 PDB CREDO	0.675	0.101	0.565	0.004
Rv0949.2	27	2cbr_A80_A_201 PDB CREDO	0.564	0.225	0.564	0.004
Rv0949.2	27	3kw2_ADN_B_300 PDB CREDO	0.632	0.143	0.563	0.004
Rv0949.2	27	1sqn_NDR_A_1001 PDB CREDO	0.627	0.148	0.562	0.004
Rv0949.2	27	1sqn_NDR_B_2001 PDB CREDO	0.624	0.151	0.560	0.004
Rv0949.2	27	2aa5_STR_A_301 PDB CREDO	0.715	0.070	0.559	0.004
Rv0949.2	27	2aa6_STR_A_401 PDB CREDO	0.715	0.070	0.559	0.004
Rv0949.2	27	2aax_PDN_A_502 PDB CREDO	0.714	0.070	0.558	0.004
Rv0949.2	27	2aax_PDN_B_503 PDB CREDO	0.713	0.071	0.558	0.004
Rv0949.2	27	2aa6_STR_B_402 PDB CREDO	0.712	0.072	0.557	0.004
Rv0949.2	27	2aa5_STR_B_302 PDB CREDO	0.711	0.072	0.556	0.005
Rv0949.2	27	1jg3_ADN_B_550 PDB CREDO	0.598	0.181	0.554	0.005
Rv0949.2	27	3oct_1N1_A_663 PDB CREDO	0.639	0.135	0.554	0.005
Rv0949.2	27	1mx1_THA_E_5 PDB CREDO	0.574	0.211	0.554	0.005
Rv0949.2	27	2w8y_NDR_B_1000 PDB CREDO	0.621	0.155	0.553	0.005
Rv0949.2	27	3oht_1N1_A_1000 PDB CREDO	0.552	0.241	0.552	0.005
Rv0949.2	27	1nhz_486_A_800 PDB CREDO	0.681	0.096	0.550	0.005
Rv0949.2	27	2ity_IRE_A_2020 PDB CREDO	0.617	0.159	0.550	0.005
Rv0949.2	27	2xkw_P1B_B_1475 PDB CREDO	0.590	0.191	0.549	0.005
Rv0949.2	27	3f4x_KLT_A_300 PDB CREDO	0.565	0.223	0.544	0.005
Rv0949.2	27	2itz_IRE_A_2021 PDB CREDO	0.634	0.140	0.543	0.006
Rv0949.2	27	1lhv_NOG_A_301 PDB CREDO	0.741	0.053	0.543	0.006
Rv0949.2	27	2gqg_1N1_A_501 PDB CREDO	0.584	0.199	0.542	0.006
Rv0949.2	26	3g1u_ADN_D_438 PDB CREDO	0.562	0.228	0.541	0.006
Rv0949.2	26	3n58_ADN_D_500 PDB CREDO	0.582	0.201	0.539	0.006
Rv0949.2	27	1p93_DEX_D_4999 PDB CREDO	0.712	0.072	0.539	0.006
Rv0949.2	27	1mx1_THA_D_4 PDB CREDO	0.605	0.173	0.539	0.006
Rv0949.2	26	3glq_RAB_B_602 PDB CREDO	0.560	0.230	0.538	0.006
Rv0949.2	27	1jg2_ADN_A_500 PDB CREDO	0.622	0.154	0.538	0.006
Rv0949.2	27	1p93_DEX_C_3999 PDB CREDO	0.711	0.072	0.538	0.006
Rv0949.2	27	3mne_DEX_A_784 PDB CREDO	0.711	0.072	0.538	0.006
Rv0949.2	26	3ce6_ADN_D_500 PDB CREDO	0.581	0.203	0.538	0.006
Rv0949.2	27	1mx1_THA_F_6 PDB CREDO	0.604	0.174	0.538	0.006
Rv0949.2	27	2xpv_MIY_A_1209 PDB CREDO	0.600	0.179	0.538	0.006
Rv0949.2	27	3kw2_ADN_A_300 PDB CREDO	0.537	0.262	0.537	0.006
Rv0949.2	26	3ce6_ADN_A_500 PDB CREDO	0.579	0.205	0.537	0.006
Rv0949.2	26	1d4f_ADN_B_602 PDB CREDO	0.578	0.206	0.536	0.006
Rv0949.2	26	3ce6_ADN_B_500 PDB CREDO	0.578	0.206	0.536	0.006
Rv0949.2	26	3ce6_ADN_C_500 PDB CREDO	0.578	0.206	0.536	0.006
Rv0949.2	27	1gs4_ZK5_A_1918 PDB CREDO	0.577	0.208	0.536	0.006
Rv0949.2	27	1m2z_DEX_A_301 PDB CREDO	0.708	0.075	0.536	0.006
Rv0949.2	27	1m2z_DEX_D_401 PDB CREDO	0.707	0.075	0.535	0.006
Rv0949.2	27	1zgy_BRL_A_503 PDB CREDO	0.662	0.113	0.535	0.006
Rv0949.2	26	3g1u_ADN_B_438 PDB CREDO	0.556	0.236	0.535	0.006
Rv0949.2	26	3glq_RAB_A_602 PDB CREDO	0.556	0.236	0.535	0.006
Rv0949.2	26	1d4f_ADN_D_604 PDB CREDO	0.577	0.208	0.535	0.006
Rv0949.2	27	2w9s_TOP_D_1158 PDB CREDO	0.678	0.099	0.535	0.006
Rv0949.2	27	4eb6_VLB_C_503 PDB CREDO	0.575	0.210	0.534	0.006
Rv0949.2	26	3g1u_ADN_A_438 PDB CREDO	0.555	0.237	0.534	0.006
Rv0949.2	26	3n58_ADN_C_500 PDB CREDO	0.555	0.237	0.534	0.006
Rv0949.2	27	3gn8_DEX_A_247 PDB CREDO	0.705	0.077	0.534	0.007
Rv0949.2	27	3gn8_DEX_B_247 PDB CREDO	0.705	0.077	0.534	0.007
Rv0949.2	27	3d90_NOG_B_2001 PDB CREDO	0.659	0.116	0.533	0.007
Rv0949.2	27	3d90_NOG_A_1001 PDB CREDO	0.657	0.118	0.531	0.007
Rv0949.2	27	3h0a_9RA_A_500 PDB CREDO	0.634	0.141	0.530	0.007
Rv0949.2	27	3ln1_CEL_D_682 PDB CREDO	0.632	0.142	0.529	0.007
Rv0949.2	27	1fr6_AZR_B_362 PDB CREDO	0.549	0.246	0.528	0.007
Rv0949.2	26	3ond_ADN_A_506 PDB CREDO	0.549	0.245	0.528	0.007
Rv0949.2	27	1s9p_DES_A_459 PDB CREDO	0.588	0.193	0.528	0.007
Rv0949.2	27	3ls4_TCI_H_220 PDB CREDO	0.591	0.189	0.527	0.007
Rv0949.2	27	1jin_KTN_A_801 PDB CREDO	0.590	0.191	0.526	0.007
Rv0949.2	27	3vri_1KX_A_301 PDB CREDO	0.590	0.191	0.526	0.007
Rv0949.2	26	2c49_ADN_A_1301 PDB CREDO	0.525	0.280	0.525	0.007
Rv0949.2	26	3g1u_ADN_C_438 PDB CREDO	0.566	0.223	0.524	0.008
Rv0949.2	27	2ayl_FLP_A_1701 PDB CREDO	0.566	0.223	0.524	0.008
Rv0949.2	27	3fuu_ADN_A_0 PDB CREDO	0.565	0.224	0.523	0.008
Rv0949.2	27	3qt0_486_A_4 PDB CREDO	0.625	0.150	0.523	0.008
Rv0949.2	27	1a28_STR_B_2 PDB CREDO	0.711	0.073	0.521	0.008
Rv0949.2	27	1ie4_T44_B_328 PDB CREDO	0.562	0.228	0.521	0.008
Rv0949.2	27	1jip_KTN_A_801 PDB CREDO	0.634	0.141	0.521	0.008
Rv0949.2	27	1fdu_EST_C_353 PDB CREDO	0.561	0.229	0.520	0.008
Rv0949.2	26	1v8b_ADN_D_3502 PDB CREDO	0.610	0.167	0.519	0.008
Rv0949.2	26	3kw2_ADN_A_300 PDB CREDO	0.560	0.231	0.519	0.008
Rv0949.2	27	2fum_MIX_A_539 PDB CREDO	0.558	0.233	0.518	0.008
Rv0949.2	26	1d4f_ADN_C_603 PDB CREDO	0.623	0.153	0.518	0.008
Rv0949.2	27	3k2h_LYA_B_514 PDB CREDO	0.577	0.207	0.518	0.008
Rv0949.2	27	1fr6_AZR_A_362 PDB CREDO	0.537	0.262	0.517	0.008
Rv0949.2	27	2ab2_SNL_B_503 PDB CREDO	0.727	0.061	0.516	0.009
Rv0949.2	27	2ab2_SNL_A_502 PDB CREDO	0.727	0.062	0.516	0.009
Rv0949.2	27	3qlg_1N1_A_601 PDB CREDO	0.555	0.237	0.514	0.009
Rv0949.2	26	1d4f_ADN_A_601 PDB CREDO	0.534	0.267	0.514	0.009
Rv0949.2	27	3o1c_ADN_A_127 PDB CREDO	0.532	0.270	0.512	0.009
Rv0949.2	27	3qlg_1N1_B_601 PDB CREDO	0.553	0.240	0.512	0.009
Rv0949.2	27	3nrr_D16_B_520 PDB CREDO	0.591	0.190	0.512	0.009
Rv0949.2	27	3g5d_1N1_B_1 PDB CREDO	0.551	0.242	0.511	0.009
Rv0949.2	27	3ads_IMN_A_2 PDB CREDO	0.590	0.191	0.511	0.009
Rv0949.2	26	1jg3_ADN_B_550 PDB CREDO	0.511	0.302	0.511	0.009
Rv0949.2	27	3k2h_LYA_A_514 PDB CREDO	0.551	0.243	0.510	0.009
Rv0949.2	26	1v8b_ADN_B_1502 PDB CREDO	0.599	0.180	0.510	0.009
Rv0949.2	27	1m17_AQ4_A_999 PDB CREDO	0.620	0.156	0.509	0.009
Rv0949.2	27	2ayl_FLP_B_2701 PDB CREDO	0.620	0.156	0.509	0.009
Rv0949.2	27	2oax_SNL_B_2001 PDB CREDO	0.718	0.068	0.509	0.009
Rv0949.2	27	3adx_IMN_A_2 PDB CREDO	0.548	0.247	0.509	0.009
Rv0949.2	27	1mx1_THA_A_1 PDB CREDO	0.645	0.129	0.509	0.010
Rv0949.2	27	2oax_SNL_C_3001 PDB CREDO	0.716	0.069	0.508	0.010
Rv0949.2	27	1z9y_FUN_A_500 PDB CREDO	0.528	0.276	0.508	0.010
Rv0949.2	26	4e3a_ADN_B_500 PDB CREDO	0.548	0.247	0.507	0.010
Rv0949.2	27	2vke_TAC_A_222 PDB CREDO	0.548	0.247	0.507	0.010
Rv0949.2	27	3ads_IMN_B_3 PDB CREDO	0.672	0.104	0.507	0.010
Rv0949.2	27	1ya4_CTX_C_3 PDB CREDO	0.569	0.219	0.507	0.010
Rv0949.2	27	3g5d_1N1_A_1 PDB CREDO	0.547	0.249	0.507	0.010
Rv0949.2	27	4e3a_ADN_B_500 PDB CREDO	0.507	0.308	0.507	0.010
Rv0949.2	26	3n58_ADN_A_500 PDB CREDO	0.609	0.168	0.506	0.010
Rv0949.2	27	3oht_1N1_B_1000 PDB CREDO	0.565	0.224	0.506	0.010
Rv0949.2	25	1wu8_ADN_B_501 PDB CREDO	0.528	0.275	0.506	0.010
Rv0949.2	27	1z9h_IMN_B_381 PDB CREDO	0.670	0.106	0.506	0.010
Rv0949.2	27	1uho_VDN_A_1000 PDB CREDO	0.641	0.133	0.505	0.010
Rv0949.2	27	1z9h_IMN_A_379 PDB CREDO	0.668	0.108	0.505	0.010
Rv0949.2	27	1z9h_IMN_C_379 PDB CREDO	0.668	0.108	0.505	0.010
Rv0949.2	27	3qgz_ADN_A_127 PDB CREDO	0.523	0.282	0.504	0.010
Rv0949.2	27	3tne_RIT_A_401 PDB CREDO	0.710	0.073	0.504	0.010
Rv0949.2	27	3vhu_SNL_A_1001 PDB CREDO	0.710	0.073	0.504	0.010
Rv0949.2	27	1uwh_BAX_B_1723 PDB CREDO	0.755	0.045	0.504	0.010
Rv0949.2	27	1z9h_IMN_D_476 PDB CREDO	0.666	0.109	0.503	0.010
Rv0949.2	27	1uwh_BAX_A_1723 PDB CREDO	0.753	0.046	0.503	0.010
Rv0949.2	27	2trt_TAC_A_222 PDB CREDO	0.587	0.195	0.502	0.011
Rv0949.2	27	2xpw_OTC_A_222 PDB CREDO	0.542	0.255	0.502	0.011
Rv0949.2	27	3d91_REM_A_350 PDB CREDO	0.799	0.025	0.502	0.011
Rv0949.2	27	3n8z_FLP_A_701 PDB CREDO	0.521	0.286	0.502	0.011
Rv0949.2	27	1fm6_BRL_X_504 PDB CREDO	0.684	0.093	0.501	0.011
Rv0949.2	27	1oq5_CEL_A_701 PDB CREDO	0.539	0.260	0.501	0.011
Rv0949.2	27	3d91_REM_B_350 PDB CREDO	0.797	0.026	0.500	0.011

Similarity to known drug target from sensitive sequence analysis

No drug targets

List of small molecules tested from TIBLE

Data not available

Off-target activity - ligand based from TIBLE

Data not available

Small molecules involved in protein-protein complex from TIMBAL .Proteins similar to Mtb based on sequence analysis.

Data not available

STITCH interactions

No high confidence interactions