SInCRe - Rv2737c

Tuberculist information

Gene name	recA
Protein function	RecA protein (recombinase A) [contains: endonuclease PI-MTUI (MTU RecA intein)].
Functional category(tuberculist)	information pathways
Gene location(kb)	3049.05
Molecular mass(da)	85389.1
External sites	TB Database TubercuList WebTB

Protein sequence

Number of amino acids : 790

	  		  	1    MTQTPDREKALELAVAQIEKSYGKGSVMRLGDEARQPISVIPTGSIALDVALGIGGLPRG   60
			  	61   RVIEIYGPESSGKTTVALHAVANAQAAGGVAAFIDAEHALDPDYAKKLGVDTDSLLVSQP  120
			  	121  DTGEQALEIADMLIRSGALDIVVIDSVAALVPRAELEGEMGDSHVGLQARLMSQALRKMT  180
			  	181  GALNNSGTTAIFINQLRDKIGVMFGSPETTTGGKALKFYASVRMDVRRVETLKDGTNAVG  240
			  	241  NRTRVKVVKNKCLAEGTRIFDPVTGTTHRIEDVVDGRKPIHVVAAAKDGTLHARPVVSWF  300
			  	301  DQGTRDVIGLRIAGGAIVWATPDHKVLTEYGWRAAGELRKGDRVAQPRRFDGFGDSAPIP  360
			  	361  ADHARLLGYLIGDGRDGWVGGKTPINFINVQRALIDDVTRIAATLGCAAHPQGRISLAIA  420
			  	421  HRPGERNGVADLCQQAGIYGKLAWEKTIPNWFFEPDIAADIVGNLLFGLFESDGWVSREQ  480
			  	481  TGALRVGYTTTSEQLAHQIHWLLLRFGVGSTVRDYDPTQKRPSIVNGRRIQSKRQVFEVR  540
			  	541  ISGMDNVTAFAESVPMWGPRGAALIQAIPEATQGRRRGSQATYLAAEMTDAVLNYLDERG  600
			  	601  VTAQEAAAMIGVASGDPRGGMKQVLGASRLRRDRVQALADALDDKFLHDMLAEELRYSVI  660
			  	661  REVLPTRRARTFDLEVEELHTLVAEGVVVHNCSPPFKQAEFDILYGKGISREGSLIDMGV  720
			  	721  DQGLIRKSGAWFTYEGEQLGQGKENARNFLVENADVADEIEKKIKEKLGIGAVVTDDPSN  780
			  	781  DGVLPAPVDF

Known structures in the PDB

No Known structures

Number of amino acids : 790

Domains assigned based on sequence.

Mtb Structural proteome models

CHOPIN models

Profile-based domain assignment

Structural/Functional domain family	Pfam acc.no./SCOP ID	Domain Region
RecA	PF00154	9-260
LAGLIDADG_3	PF14528	463-555
RecA	PF00154	655-770

Mtb Structural Proteome models

Model Number	1
Model name	Rv2737c_2in0_A
Template	2IN0 APDB CREDO
Template coverage	1_440
Template Identity(%)	100.0
Model coverage(%)	55.6
Normalized DOPE score	-1.884

Model Number	2
Model name	Rv2737c_2imz_A
Template	2IMZ APDB CREDO
Template coverage	2_439
Template Identity(%)	100.0
Model coverage(%)	55.3
Normalized DOPE score	-1.371

Model Number	3
Model name	Rv2737c_1mo3_A
Template	1MO3 APDB CREDO
Template coverage	1_329
Template Identity(%)	100.0
Model coverage(%)	41.5
Normalized DOPE score	-0.995

Model Number	4
Model name	Rv2737c.10
Template	1AA3 APDB CREDO
Template coverage	268_327
Template Identity(%)	51.7
Model coverage(%)	7.5
Normalized DOPE score	-0.925

Model Number	5
Model name	Rv2737c.8
Template	2DCH XPDB CREDO
Template coverage	-8_188
Template Identity(%)	16.5
Model coverage(%)	27.2
Normalized DOPE score	0.177

Model Number	6
Model name	Rv2737c
Template	1G19 APDB CREDO
Template coverage	1_318
Template Identity(%)	81.0
Model coverage(%)	42.5
Normalized DOPE score	0.229

Model Number	7
Model name	Rv2737c.7
Template	1DQ3 APDB CREDO
Template coverage	10_454
Template Identity(%)	14.6
Model coverage(%)	57.8
Normalized DOPE score	0.912

Model Number	8
Model name	Rv2737c.9
Template	2G88 APDB CREDO
Template coverage	94_349
Template Identity(%)	44.5
Model coverage(%)	30.4
Normalized DOPE score	1.419

Structure Models from Chopin

CHOPIN models not available for this query

Binding pockets

STRING

Cytoscape Web will replace the contents of this div with protein-protein interaction network.

Protein interacting with Rv2737c	Gene name	Confidence Score
Rv2720	lexA	0.997
Rv2720	lexA	0.997
Rv2736c	recX	0.976
Rv2973c	recG	0.975
Rv2973c	recG	0.975
Rv2973c	recG	0.975
Rv2593c	ruvA	0.96
Rv2593c	ruvA	0.96
Rv2593c	ruvA	0.96
Rv2592c	ruvB	0.955
Rv2592c	ruvB	0.955
Rv2555c	alaS	0.948
Rv2555c	alaS	0.948
Rv2555c	alaS	0.948
Rv3715c	recR	0.936
Rv3715c	recR	0.936
Rv3715c	recR	0.936
Rv1638	uvrA	0.93
Rv1633	uvrB	0.927
Rv1633	uvrB	0.927
Rv1633	uvrB	0.927
Rv1633	uvrB	0.927
Rv1023	eno	0.926
Rv1023	eno	0.926
Rv2916c	ffh	0.923
Rv2916c	ffh	0.923
Rv2916c	ffh	0.923
Rv1696	recN	0.92
Rv2150c	ftsZ	0.916
Rv2150c	ftsZ	0.916
Rv0350	dnaK	0.915
Rv1699	pyrG	0.912
Rv1699	pyrG	0.912
Rv3646c	topA	0.91
Rv1630	rpsA	0.91
Rv3646c	topA	0.91
Rv3646c	topA	0.91
Rv3709c	ask	0.909
Rv3709c	ask	0.909
Rv3709c	ask	0.909
Rv0949	uvrD1	0.905
Rv0006	gyrA	0.905
Rv0006	gyrA	0.905
Rv0949	uvrD1	0.905
Rv1901	cinA	0.903
Rv1901	cinA	0.903
Rv2594c	ruvC	0.902

Potential ligand/drug binding sites

Protein Model	Pocket Number	Drug Binding Site	PMIN Score	Pvalue PMIN	PMAX Score	Pvalue PMAX
Rv2737c.9	6	1ya4_CTX_A_1 PDB CREDO	0.622	0.154	0.579	0.003
Rv2737c.9	6	3sm2_478_A_126 PDB CREDO	0.659	0.116	0.569	0.004
Rv2737c.9	6	3bjw_SVR_B_501 PDB CREDO	0.692	0.087	0.569	0.004
Rv2737c.7	7	1xzx_T3_X_500 PDB CREDO	0.566	0.222	0.566	0.004
Rv2737c.9	6	3bjw_SVR_F_502 PDB CREDO	0.688	0.090	0.566	0.004
Rv2737c.7	7	1bsx_T3_A_1 PDB CREDO	0.584	0.199	0.565	0.004
Rv2737c.7	7	1bsx_T3_B_2 PDB CREDO	0.584	0.199	0.565	0.004
Rv2737c.9	6	2xkw_P1B_A_1478 PDB CREDO	0.670	0.105	0.565	0.004
Rv2737c.7	7	3gws_T3_X_500 PDB CREDO	0.583	0.200	0.565	0.004
Rv2737c.7	7	2h79_T3_A_1 PDB CREDO	0.601	0.178	0.563	0.004
Rv2737c.9	7	3v5w_8PR_A_701 PDB CREDO	0.600	0.179	0.562	0.004
Rv2737c.9	6	3bjw_SVR_H_504 PDB CREDO	0.683	0.094	0.561	0.004
Rv2737c.7	7	3uvv_T3_A_501 PDB CREDO	0.561	0.229	0.561	0.004
Rv2737c.7	7	2h77_T3_A_1 PDB CREDO	0.614	0.162	0.557	0.004
Rv2737c.9	4	1uwj_BAX_A_1723 PDB CREDO	0.588	0.193	0.556	0.005
Rv2737c.7	10	2y6o_1N1_A_1892 PDB CREDO	0.591	0.189	0.555	0.005
Rv2737c.9	7	3oez_STI_B_601 PDB CREDO	0.632	0.143	0.555	0.005
Rv2737c.7	7	3qt0_486_A_4 PDB CREDO	0.633	0.142	0.555	0.005
Rv2737c.10	3	3fuu_ADN_A_0 PDB CREDO	0.594	0.187	0.550	0.005
Rv2737c.7	7	1fm6_BRL_X_504 PDB CREDO	0.550	0.244	0.550	0.005
Rv2737c.7	10	1uwh_BAX_B_1723 PDB CREDO	0.567	0.221	0.550	0.005
Rv2737c.7	7	3ln1_CEL_C_682 PDB CREDO	0.567	0.220	0.549	0.005
Rv2737c.9	6	1xkk_FMM_A_91 PDB CREDO	0.669	0.107	0.549	0.005
Rv2737c.9	6	3bjw_SVR_E_503 PDB CREDO	0.723	0.064	0.549	0.005
Rv2737c.7	7	3ln1_CEL_B_682 PDB CREDO	0.566	0.222	0.548	0.005
Rv2737c.7	10	1uwh_BAX_A_1723 PDB CREDO	0.565	0.224	0.548	0.005
Rv2737c.7	7	1uob_PNN_A_1311 PDB CREDO	0.620	0.156	0.548	0.005
Rv2737c.7	10	1kij_NOV_A_400 PDB CREDO	0.665	0.111	0.547	0.005
Rv2737c.7	7	3ln1_CEL_A_682 PDB CREDO	0.564	0.225	0.546	0.005
Rv2737c.7	10	1uwj_BAX_B_1723 PDB CREDO	0.598	0.182	0.546	0.005
Rv2737c.10	3	3kw2_ADN_A_300 PDB CREDO	0.545	0.251	0.545	0.005
Rv2737c.7	10	4asd_BAX_A_1500 PDB CREDO	0.596	0.184	0.544	0.006
Rv2737c.7	10	1uob_PNN_A_1311 PDB CREDO	0.576	0.208	0.542	0.006
Rv2737c.7	28	3gp0_NIL_A_1 PDB CREDO	0.556	0.236	0.542	0.006
Rv2737c.9	7	1t7j_478_A_200 PDB CREDO	0.656	0.119	0.541	0.006
Rv2737c.9	7	2fum_MIX_D_3539 PDB CREDO	0.560	0.230	0.541	0.006
Rv2737c.9	4	1t46_STI_A_3 PDB CREDO	0.587	0.195	0.541	0.006
Rv2737c.7	9	3bjw_SVR_B_512 PDB CREDO	0.555	0.237	0.541	0.006
Rv2737c.7	7	1kij_NOV_A_400 PDB CREDO	0.612	0.165	0.536	0.006
Rv2737c.7	7	1y0x_T44_X_500 PDB CREDO	0.588	0.194	0.535	0.006
Rv2737c.7	7	1qkn_RAL_A_600 PDB CREDO	0.553	0.240	0.535	0.006
Rv2737c.10	3	2pgf_ADN_A_501 PDB CREDO	0.535	0.266	0.535	0.006
Rv2737c.7	10	2fum_MIX_D_3539 PDB CREDO	0.649	0.125	0.534	0.006
Rv2737c.7	10	3hec_STI_A_1 PDB CREDO	0.550	0.244	0.533	0.007
Rv2737c.7	10	3oez_STI_B_601 PDB CREDO	0.549	0.245	0.532	0.007
Rv2737c.7	28	3cs9_NIL_C_600 PDB CREDO	0.561	0.229	0.532	0.007
Rv2737c.7	10	1uwj_BAX_A_1723 PDB CREDO	0.635	0.140	0.531	0.007
Rv2737c.7	28	3cs9_NIL_D_600 PDB CREDO	0.560	0.231	0.531	0.007
Rv2737c.7	9	3bjw_SVR_B_501 PDB CREDO	0.545	0.251	0.531	0.007
Rv2737c.7	10	3tne_RIT_A_401 PDB CREDO	0.548	0.247	0.531	0.007
Rv2737c.9	7	3tne_RIT_A_401 PDB CREDO	0.605	0.174	0.531	0.007
Rv2737c.7	10	3uvv_T3_A_501 PDB CREDO	0.565	0.224	0.530	0.007
Rv2737c.9	7	2y6o_1N1_A_1892 PDB CREDO	0.585	0.198	0.530	0.007
Rv2737c.7	9	1xkk_FMM_A_91 PDB CREDO	0.543	0.254	0.529	0.007
Rv2737c.9	7	2jfa_RAL_A_600 PDB CREDO	0.603	0.176	0.529	0.007
Rv2737c.7	28	1t46_STI_A_3 PDB CREDO	0.555	0.236	0.527	0.007
Rv2737c.9	6	3b0w_DGX_B_1 PDB CREDO	0.753	0.046	0.527	0.007
Rv2737c.7	9	3bjw_SVR_F_509 PDB CREDO	0.553	0.239	0.526	0.007
Rv2737c.9	6	3kk6_CEL_A_701 PDB CREDO	0.640	0.134	0.526	0.007
Rv2737c.7	7	2y6o_1N1_A_1892 PDB CREDO	0.526	0.279	0.526	0.007
Rv2737c.7	7	3ln1_CEL_D_682 PDB CREDO	0.600	0.179	0.526	0.007
Rv2737c.7	28	1xkk_FMM_A_91 PDB CREDO	0.526	0.279	0.526	0.007
Rv2737c.7	7	1uwj_BAX_B_1723 PDB CREDO	0.612	0.164	0.525	0.007
Rv2737c.7	10	1xzx_T3_X_500 PDB CREDO	0.559	0.231	0.525	0.007
Rv2737c.7	9	2xkw_P1B_A_1478 PDB CREDO	0.525	0.280	0.525	0.007
Rv2737c.9	4	4asd_BAX_A_1500 PDB CREDO	0.605	0.173	0.524	0.008
Rv2737c.7	28	1opj_STI_A_3 PDB CREDO	0.599	0.180	0.524	0.008
Rv2737c.9	1	1d4f_ADN_A_601 PDB CREDO	0.568	0.219	0.524	0.008
Rv2737c.9	7	3hec_STI_A_1 PDB CREDO	0.596	0.184	0.523	0.008
Rv2737c.7	7	3nrr_D16_B_520 PDB CREDO	0.618	0.158	0.523	0.008
Rv2737c.7	10	2hyy_STI_B_600 PDB CREDO	0.556	0.235	0.523	0.008
Rv2737c.7	9	3bjw_SVR_F_502 PDB CREDO	0.537	0.263	0.523	0.008
Rv2737c.7	10	3gws_T3_X_500 PDB CREDO	0.575	0.210	0.523	0.008
Rv2737c.7	7	1zgy_BRL_A_503 PDB CREDO	0.577	0.208	0.523	0.008
Rv2737c.7	10	2h79_T3_A_1 PDB CREDO	0.594	0.186	0.523	0.008
Rv2737c.7	9	3bjw_SVR_H_504 PDB CREDO	0.536	0.264	0.522	0.008
Rv2737c.7	9	3bjw_SVR_H_511 PDB CREDO	0.549	0.245	0.522	0.008
Rv2737c.7	28	1opj_STI_B_4 PDB CREDO	0.597	0.183	0.522	0.008
Rv2737c.7	10	1y0x_T44_X_500 PDB CREDO	0.538	0.261	0.522	0.008
Rv2737c.7	9	3bjw_SVR_E_510 PDB CREDO	0.549	0.246	0.522	0.008
Rv2737c.7	7	3k2h_LYA_B_514 PDB CREDO	0.638	0.137	0.521	0.008
Rv2737c.7	10	3tne_RIT_B_401 PDB CREDO	0.538	0.261	0.521	0.008
Rv2737c.7	9	3bjw_SVR_E_503 PDB CREDO	0.578	0.206	0.521	0.008
Rv2737c.7	10	1bsx_T3_A_1 PDB CREDO	0.573	0.213	0.521	0.008
Rv2737c.7	10	1bsx_T3_B_2 PDB CREDO	0.573	0.213	0.521	0.008
Rv2737c.7	7	3oez_STI_B_601 PDB CREDO	0.537	0.263	0.520	0.008
Rv2737c.9	4	1opj_STI_B_4 PDB CREDO	0.520	0.288	0.520	0.008
Rv2737c.9	7	2hyy_STI_B_600 PDB CREDO	0.649	0.125	0.520	0.008
Rv2737c.9	30	3ti1_B49_A_299 PDB CREDO	0.540	0.258	0.520	0.008
Rv2737c.9	4	1opj_STI_A_3 PDB CREDO	0.519	0.288	0.519	0.008
Rv2737c.7	7	2hw2_RFP_A_1200 PDB CREDO	0.536	0.265	0.519	0.008
Rv2737c.7	7	1uwh_BAX_A_1723 PDB CREDO	0.569	0.218	0.518	0.008
Rv2737c.7	10	1hwi_115_D_3 PDB CREDO	0.534	0.266	0.518	0.008
Rv2737c.9	4	1uwj_BAX_B_1723 PDB CREDO	0.597	0.183	0.518	0.008
Rv2737c.7	7	1uwh_BAX_B_1723 PDB CREDO	0.568	0.219	0.517	0.008
Rv2737c.7	10	2h77_T3_A_1 PDB CREDO	0.607	0.170	0.517	0.008
Rv2737c.9	7	4asd_BAX_A_1500 PDB CREDO	0.665	0.110	0.517	0.008
Rv2737c_2in0_A	1	3rem_SAL_A_301 PDB CREDO	0.544	0.253	0.517	0.008
Rv2737c.7	7	2fum_MIX_D_3539 PDB CREDO	0.590	0.192	0.517	0.008
Rv2737c.10	3	1kij_NOV_B_444 PDB CREDO	0.536	0.264	0.516	0.008
Rv2737c.7	28	3k5v_STI_A_2 PDB CREDO	0.606	0.171	0.516	0.009
Rv2737c.9	4	1uob_PNN_A_1311 PDB CREDO	0.613	0.164	0.516	0.009
Rv2737c.7	7	1uwj_BAX_A_1723 PDB CREDO	0.656	0.119	0.515	0.009
Rv2737c_2imz_A	1	2vfu_MTL_A_1419 PDB CREDO	0.515	0.295	0.515	0.009
Rv2737c.7	10	3heg_BAX_A_1 PDB CREDO	0.547	0.248	0.515	0.009
Rv2737c.9	7	1kij_NOV_A_400 PDB CREDO	0.532	0.269	0.515	0.009
Rv2737c.9	4	1xkk_FMM_A_91 PDB CREDO	0.588	0.194	0.514	0.009
Rv2737c.9	4	3cs9_NIL_A_600 PDB CREDO	0.514	0.296	0.514	0.009
Rv2737c.9	4	3pyy_STI_A_3 PDB CREDO	0.560	0.230	0.514	0.009
Rv2737c.7	7	3tkd_CYZ_A_266 PDB CREDO	0.530	0.272	0.514	0.009
Rv2737c.7	9	1hwk_117_B_1 PDB CREDO	0.655	0.119	0.514	0.009
Rv2737c.7	7	2x9g_LYA_A_1270 PDB CREDO	0.514	0.297	0.514	0.009
Rv2737c.9	6	2v0z_C41_C_1328 PDB CREDO	0.594	0.186	0.514	0.009
Rv2737c.7	7	3oct_1N1_A_663 PDB CREDO	0.606	0.172	0.513	0.009
Rv2737c.9	30	2zva_1N1_A_513 PDB CREDO	0.513	0.298	0.513	0.009
Rv2737c.10	4	2fn1_SAL_A_506 PDB CREDO	0.541	0.257	0.513	0.009
Rv2737c.7	28	2xkw_P1B_A_1478 PDB CREDO	0.526	0.278	0.513	0.009
Rv2737c.7	28	3oez_STI_A_601 PDB CREDO	0.638	0.137	0.513	0.009
Rv2737c_2in0_A	1	3rem_SAL_B_301 PDB CREDO	0.540	0.258	0.513	0.009
Rv2737c.9	4	1hwk_117_B_1 PDB CREDO	0.558	0.233	0.513	0.009
Rv2737c.9	4	3k5v_STI_A_2 PDB CREDO	0.527	0.277	0.513	0.009
Rv2737c.7	10	1hwi_115_B_1 PDB CREDO	0.528	0.276	0.512	0.009
Rv2737c.10	4	2fn1_SAL_B_503 PDB CREDO	0.539	0.259	0.511	0.009
Rv2737c.9	4	3bjw_SVR_E_503 PDB CREDO	0.540	0.258	0.511	0.009
Rv2737c.9	7	2pl0_STI_A_200 PDB CREDO	0.638	0.136	0.511	0.009
Rv2737c.7	7	3ua1_08Y_A_600 PDB CREDO	0.511	0.301	0.511	0.009
Rv2737c.7	28	1iep_STI_B_202 PDB CREDO	0.635	0.139	0.511	0.009
Rv2737c.7	10	2oiq_STI_A_1001 PDB CREDO	0.543	0.254	0.511	0.009
Rv2737c.7	9	3bjw_SVR_C_505 PDB CREDO	0.567	0.221	0.511	0.009
Rv2737c.9	7	3tne_RIT_B_401 PDB CREDO	0.581	0.202	0.510	0.009
Rv2737c.9	4	3oez_STI_A_601 PDB CREDO	0.555	0.237	0.510	0.009
Rv2737c.7	10	3gcs_BAX_A_401 PDB CREDO	0.559	0.232	0.510	0.009
Rv2737c.7	7	2jfa_RAL_A_600 PDB CREDO	0.526	0.278	0.510	0.009
Rv2737c.7	7	3vn2_TLS_A_501 PDB CREDO	0.543	0.254	0.510	0.009
Rv2737c.9	4	2hyy_STI_A_600 PDB CREDO	0.554	0.238	0.510	0.009
Rv2737c.7	10	2jfa_RAL_A_600 PDB CREDO	0.525	0.280	0.509	0.009
Rv2737c.9	7	3u7s_017_A_201 PDB CREDO	0.509	0.304	0.509	0.009
Rv2737c.7	7	4asd_BAX_A_1500 PDB CREDO	0.593	0.187	0.509	0.010
Rv2737c.9	30	3kw2_ADN_A_300 PDB CREDO	0.571	0.215	0.509	0.010
Rv2737c.10	3	1d4f_ADN_B_602 PDB CREDO	0.508	0.306	0.508	0.010
Rv2737c.9	4	2hyy_STI_C_600 PDB CREDO	0.553	0.240	0.508	0.010
Rv2737c.9	6	1t46_STI_A_3 PDB CREDO	0.651	0.123	0.508	0.010
Rv2737c_2in0_A	1	1h9z_RWF_A_3001 PDB CREDO	0.534	0.266	0.508	0.010
Rv2737c.9	4	2hyy_STI_D_600 PDB CREDO	0.552	0.241	0.508	0.010
Rv2737c.9	7	1d4s_TPV_A_201 PDB CREDO	0.507	0.307	0.507	0.010
Rv2737c.9	7	3spk_TPV_A_100 PDB CREDO	0.507	0.307	0.507	0.010
Rv2737c.7	28	3mss_STI_B_1 PDB CREDO	0.631	0.144	0.507	0.010
Rv2737c.7	7	2gqg_1N1_B_502 PDB CREDO	0.541	0.257	0.507	0.010
Rv2737c.9	4	1iep_STI_B_202 PDB CREDO	0.552	0.242	0.507	0.010
Rv2737c.9	4	3mss_STI_B_1 PDB CREDO	0.552	0.242	0.507	0.010
Rv2737c.7	28	1iep_STI_A_201 PDB CREDO	0.630	0.145	0.507	0.010
Rv2737c.10	3	1jzs_MRC_A_1301 PDB CREDO	0.526	0.278	0.507	0.010
Rv2737c.7	28	3pyy_STI_A_3 PDB CREDO	0.630	0.145	0.506	0.010
Rv2737c.9	4	3ms9_STI_B_1 PDB CREDO	0.551	0.242	0.506	0.010
Rv2737c.7	28	3ms9_STI_B_1 PDB CREDO	0.629	0.146	0.506	0.010
Rv2737c.7	28	3pyy_STI_B_4 PDB CREDO	0.629	0.146	0.506	0.010
Rv2737c.9	30	3g5d_1N1_B_1 PDB CREDO	0.526	0.278	0.506	0.010
Rv2737c.9	4	3gp0_NIL_A_1 PDB CREDO	0.563	0.226	0.506	0.010
Rv2737c.7	9	1t46_STI_A_3 PDB CREDO	0.547	0.249	0.506	0.010
Rv2737c.7	9	3bjw_SVR_G_506 PDB CREDO	0.547	0.249	0.506	0.010
Rv2737c.7	10	3tkd_CYZ_B_267 PDB CREDO	0.521	0.286	0.505	0.010
Rv2737c.9	4	3pyy_STI_B_4 PDB CREDO	0.550	0.244	0.505	0.010
Rv2737c.7	10	3tkd_CYZ_A_266 PDB CREDO	0.521	0.286	0.505	0.010
Rv2737c.9	30	3g5d_1N1_A_1 PDB CREDO	0.525	0.279	0.505	0.010
Rv2737c.10	3	1d4f_ADN_D_604 PDB CREDO	0.505	0.310	0.505	0.010
Rv2737c.7	28	2hyy_STI_D_600 PDB CREDO	0.628	0.147	0.505	0.010
Rv2737c.10	4	2jih_097_A_1001 PDB CREDO	0.532	0.270	0.505	0.010
Rv2737c.7	28	3k5v_STI_B_2 PDB CREDO	0.628	0.147	0.505	0.010
Rv2737c.9	4	3k5v_STI_B_2 PDB CREDO	0.549	0.245	0.505	0.010
Rv2737c.9	4	3cs9_NIL_C_600 PDB CREDO	0.547	0.248	0.505	0.010
Rv2737c.9	30	3qlg_1N1_A_601 PDB CREDO	0.525	0.281	0.505	0.010
Rv2737c.7	28	2hyy_STI_A_600 PDB CREDO	0.627	0.148	0.504	0.010
Rv2737c.7	28	3mss_STI_D_1 PDB CREDO	0.627	0.148	0.504	0.010
Rv2737c.7	7	1lhv_NOG_A_301 PDB CREDO	0.504	0.312	0.504	0.010
Rv2737c.7	7	2oiq_STI_A_1001 PDB CREDO	0.571	0.216	0.504	0.010
Rv2737c.9	4	3mss_STI_D_1 PDB CREDO	0.548	0.246	0.504	0.010
Rv2737c.9	4	3cs9_NIL_D_600 PDB CREDO	0.546	0.250	0.504	0.010
Rv2737c.7	28	3mss_STI_A_1 PDB CREDO	0.626	0.149	0.503	0.010
Rv2737c.7	28	3mss_STI_C_1 PDB CREDO	0.626	0.149	0.503	0.010
Rv2737c_2in0_A	1	2x1l_ADN_A_601 PDB CREDO	0.503	0.313	0.503	0.010
Rv2737c.7	28	2hyy_STI_C_600 PDB CREDO	0.626	0.150	0.503	0.010
Rv2737c.9	30	3qlg_1N1_B_601 PDB CREDO	0.523	0.283	0.503	0.010
Rv2737c.9	4	3ms9_STI_A_1 PDB CREDO	0.547	0.248	0.503	0.010
Rv2737c.9	4	3mss_STI_A_1 PDB CREDO	0.547	0.248	0.503	0.010
Rv2737c.7	28	3gvu_STI_A_1001 PDB CREDO	0.624	0.151	0.502	0.011
Rv2737c.9	7	3ogp_017_A_200 PDB CREDO	0.627	0.148	0.502	0.011
Rv2737c.9	30	1ki3_PE2_A_1 PDB CREDO	0.502	0.315	0.502	0.011
Rv2737c.7	10	1err_RAL_B_600 PDB CREDO	0.502	0.315	0.502	0.011
Rv2737c.9	4	1iep_STI_A_201 PDB CREDO	0.546	0.249	0.502	0.011
Rv2737c.9	4	3mss_STI_C_1 PDB CREDO	0.546	0.249	0.502	0.011
Rv2737c.9	30	1jzs_MRC_A_1301 PDB CREDO	0.542	0.255	0.501	0.011
Rv2737c.7	7	2jfa_RAL_B_600 PDB CREDO	0.534	0.267	0.501	0.011
Rv2737c.9	7	2jfa_RAL_B_600 PDB CREDO	0.589	0.193	0.501	0.011
Rv2737c.7	28	3ms9_STI_A_1 PDB CREDO	0.623	0.153	0.501	0.011
Rv2737c.7	7	1cil_ETS_A_263 PDB CREDO	0.572	0.215	0.501	0.011
Rv2737c.9	7	2fum_MIX_A_539 PDB CREDO	0.575	0.210	0.501	0.011
Rv2737c.7	7	1err_RAL_A_600 PDB CREDO	0.533	0.268	0.500	0.011
Rv2737c.10	3	3k54_1N1_A_1 PDB CREDO	0.519	0.289	0.500	0.011
Rv2737c.9	4	3cs9_NIL_B_600 PDB CREDO	0.514	0.297	0.500	0.011

Similarity to known drug target from sensitive sequence analysis

No drug targets

List of small molecules tested from TIBLE

Data not available

Off-target activity - ligand based from TIBLE

Data not available

Small molecules involved in protein-protein complex from TIMBAL .Proteins similar to Mtb based on sequence analysis.

Target name	CHEMBL ID	SMILES
Rad51	COC(=O)c1cccc2[nH]ccc12
Rad51	Cc1cc2nc3c(nc2cc1C)[C@]4(CCC3(C)C4(C)C)C(=O)O
Rad51	O=C1N(Cc2ccccc2)C(=Nc3ccccc13)C=Cc4cccnc4
Rad51	c1n[nH]c2ccccc12
Rad51	Oc1ccc2ccccc2c1
Rad51	Oc1ccc2[nH]ccc2c1
Rad51	Nc1nc2ccccc2s1
Rad51	COC(=O)[C@@H](N)Cc1c[nH]c2ccccc12
Rad51	Cc1ccc2[nH]ccc2c1
Rad51	Oc1cccc2ccccc12

STITCH interactions

Chemical Name	Confidence score	Molecular Weight
adenosine 5'-O-(3-thiotriphosphate)PubChem	0.987	523.247
adenosine diphosphatePubChem	0.975	427.201
[[[(2R,3S,4R,5R)-5-(6-aminopurin-9-yl)-3,4-dihydroxyoxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-hydroxPubChem	0.975	523.247
phosphatePubChem	0.975	96.9872
hydron diphosphatePubChem	0.975	391.981
aluminum fluoridePubChem	0.962	83.9767
hydron sulfatePubChem	0.961	196.157
Trihydrogen hexafluoroaluminatePubChem	0.961	143.996
sulfatePubChem	0.961	96.0626
deoxyadenosine triphosphatePubChem	0.96	491.182
aspartimidePubChem	0.9	114.103
(3S)-3-aminopyrrolidine-2,5-dionePubChem	0.9	114.103
zincPubChem	0.9	65.409
magnesiumPubChem	0.895	24.305
glycerolPubChem	0.76	92.0938