SInCRe - Rv3014c

Tuberculist information

Gene name	ligA
Protein function	DNA ligase [NAD dependent] LigA (polydeoxyribonucleotide synthase [NAD+])
Functional category(tuberculist)	information pathways
Gene location(kb)	3372.54
Molecular mass(da)	75257.1
External sites	TB Database TubercuList WebTB

Protein sequence

Number of amino acids : 691

	  		  	1    VSSPDADQTAPEVLRQWQALAEEVREHQFRYYVRDAPIISDAEFDELLRRLEALEEQHPE   60
			  	61   LRTPDSPTQLVGGAGFATDFEPVDHLERMLSLDNAFTADELAAWAGRIHAEVGDAAHYLC  120
			  	121  ELKIDGVALSLVYREGRLTRASTRGDGRTGEDVTLNARTIADVPERLTPGDDYPVPEVLE  180
			  	181  VRGEVFFRLDDFQALNASLVEEGKAPFANPRNSAAGSLRQKDPAVTARRRLRMICHGLGH  240
			  	241  VEGFRPATLHQAYLALRAWGLPVSEHTTLATDLAGVRERIDYWGEHRHEVDHEIDGVVVK  300
			  	301  VDEVALQRRLGSTSRAPRWAIAYKYPPEEAQTKLLDIRVNVGRTGRITPFAFMTPVKVAG  360
			  	361  STVGQATLHNASEIKRKGVLIGDTVVIRKAGDVIPEVLGPVVELRDGSEREFIMPTTCPE  420
			  	421  CGSPLAPEKEGDADIRCPNARGCPGQLRERVFHVASRNGLDIEVLGYEAGVALLQAKVIA  480
			  	481  DEGELFALTERDLLRTDLFRTKAGELSANGKRLLVNLDKAKAAPLWRVLVALSIRHVGPT  540
			  	541  AARALATEFGSLDAIAAASTDQLAAVEGVGPTIAAAVTEWFAVDWHREIVDKWRAAGVRM  600
			  	601  VDERDESVPRTLAGLTIVVTGSLTGFSRDDAKEAIVARGGKAAGSVSKKTNYVVAGDSPG  660
			  	661  SKYDKAVELGVPILDEDGFRRLLADGPASRT

Known structures in the PDB

	PDB ID	1ZAU
	Total residue count	328
	Number of chains	1
	Method	X-RAY
	Resolution	3.15

	PDB ID	3SGI
	Total residue count	615
	Number of chains	1
	Method	X-RAY
	Resolution	3.5

Profile-based domain assignment

Structural/Functional domain family	Pfam acc.no./SCOP ID	Domain Region
DNA_ligase_aden	PF01653	11-328
DNA_ligase_OB	PF03120	330-411
DNA_ligase_ZBD	PF03119	417-445
HHH_2	PF12826	527-590
BRCT	PF00533	607-683

Mtb Structural Proteome models

Model Number	1
Model name	Rv3014c.4
Template	2COK APDB CREDO
Template coverage	2_90
Template Identity(%)	20.7
Model coverage(%)	12.4
Normalized DOPE score	-0.707

Model Number	2
Model name	Rv3014c.3
Template	1X2I APDB CREDO
Template coverage	11_60
Template Identity(%)	38.0
Model coverage(%)	7.1
Normalized DOPE score	-0.442

Model Number	3
Model name	Rv3014c
Template	1ZAU APDB CREDO
Template coverage	8_328
Template Identity(%)	100.0
Model coverage(%)	46.3
Normalized DOPE score	-0.153

Model Number	4
Model name	Rv3014c.5
Template	1L7B APDB CREDO
Template coverage	1_79
Template Identity(%)	45.6
Model coverage(%)	11.4
Normalized DOPE score	-0.055

Model Number	5
Model name	Rv3014c.2
Template	1DGS APDB CREDO
Template coverage	1_581
Template Identity(%)	43.5
Model coverage(%)	86.1
Normalized DOPE score	0.106

Model Number	6
Model name	Rv3014c_1zau_A
Template	1ZAU APDB CREDO
Template coverage	8_328
Template Identity(%)	100.0
Model coverage(%)	46.3
Normalized DOPE score	0.541

Structure Models from Chopin

Model Number	1
Profile	a.60.2.2, b.40.4.6, d.142.2.2 - 1.10.150.20, 1.10.287.610, 2.40.50.140, 3.30.1490.70, 3.30.470.30 Click for model details
zscore	88.5
Residue begin	8
Residue end	603

Model Number	2
Profile	d.142.2.2 Click for model details
zscore	69.17
Residue begin	7
Residue end	328

Model Number	3
Profile	1.10.287.610, 3.30.1490.70, 3.30.470.30 Click for model details
zscore	65.36
Residue begin	10
Residue end	327

Model Number	4
Profile	a.60.2.2 Click for model details
zscore	37.2
Residue begin	413
Residue end	603

Model Number	5
Profile	1.10.287.610 Click for model details
zscore	16.15
Residue begin	8
Residue end	77

Model Number	6
Profile	3.30.1490.70 Click for model details
zscore	15.54
Residue begin	214
Residue end	328

Model Number	7
Profile	c.15.1.5 Click for model details
zscore	11.77
Residue begin	607
Residue end	683

Model Number	8
Profile	3.30.470.30 Click for model details
zscore	11.12
Residue begin	126
Residue end	287

Model Number	9
Profile	c.15.1.5 Click for model details
zscore	10.85
Residue begin	570
Residue end	691

Binding pockets

STRING

Cytoscape Web will replace the contents of this div with protein-protein interaction network.

Protein interacting with Rv3014c	Gene name	Confidence Score
Rv1633	uvrB	0.97
Rv1633	uvrB	0.97
Rv1633	uvrB	0.97
Rv1633	uvrB	0.97
Rv0949	uvrD1	0.968
Rv0949	uvrD1	0.968
Rv3455c	truA	0.968
Rv1638	uvrA	0.966
Rv1023	eno	0.942
Rv1023	eno	0.942
Rv3356c	folD	0.935
Rv3356c	folD	0.935
Rv3715c	recR	0.931
Rv3715c	recR	0.931
Rv3715c	recR	0.931
Rv1696	recN	0.917
Rv3731	ligC	0.91
Rv3731	ligC	0.91
Rv0733	adk	0.909
Rv0938	ligD	0.902
Rv0938	ligD	0.902
Rv0938	ligD	0.902
Rv0938	ligD	0.902
Rv3240c	secA1	0.901
Rv3240c	secA1	0.901
Rv3240c	secA1	0.901

Potential ligand/drug binding sites

Protein Model	Pocket Number	Drug Binding Site	PMIN Score	Pvalue PMIN	PMAX Score	Pvalue PMAX
Rv3014c.2	6	1xkk_FMM_A_91 PDB CREDO	0.681	0.096	0.646	0.001
Rv3014c.2	6	3gp0_NIL_A_1 PDB CREDO	0.648	0.127	0.631	0.001
Rv3014c.2	6	1t46_STI_A_3 PDB CREDO	0.620	0.156	0.620	0.001
Rv3014c.2	6	2xkw_P1B_A_1478 PDB CREDO	0.648	0.126	0.599	0.002
Rv3014c.2	16	3oht_1N1_A_1000 PDB CREDO	0.597	0.182	0.597	0.002
Rv3014c.2	16	3kw2_ADN_A_300 PDB CREDO	0.593	0.188	0.593	0.002
Rv3014c.2	16	3ti1_B49_A_299 PDB CREDO	0.638	0.137	0.591	0.002
Rv3014c.2	31	1uwj_BAX_A_1723 PDB CREDO	0.623	0.153	0.589	0.003
Rv3014c.2	16	3g5d_1N1_B_1 PDB CREDO	0.633	0.141	0.587	0.003
Rv3014c.2	16	3qlg_1N1_A_601 PDB CREDO	0.632	0.143	0.586	0.003
Rv3014c.2	16	3qlg_1N1_B_601 PDB CREDO	0.631	0.144	0.585	0.003
Rv3014c.2	2	1hwl_FBI_B_1 PDB CREDO	0.585	0.198	0.585	0.003
Rv3014c.2	31	1t46_STI_A_3 PDB CREDO	0.634	0.141	0.584	0.003
Rv3014c.2	2	1hwl_FBI_D_3 PDB CREDO	0.582	0.201	0.582	0.003
Rv3014c.2	16	3g5d_1N1_A_1 PDB CREDO	0.625	0.150	0.579	0.003
Rv3014c.2	2	1hwl_FBI_A_2 PDB CREDO	0.577	0.208	0.577	0.003
Rv3014c.2	2	1hwl_FBI_C_4 PDB CREDO	0.577	0.208	0.577	0.003
Rv3014c.2	2	1hwk_117_D_3 PDB CREDO	0.593	0.187	0.576	0.003
Rv3014c.2	2	1hwk_117_A_2 PDB CREDO	0.589	0.193	0.572	0.003
Rv3014c.2	2	1hwk_117_C_4 PDB CREDO	0.588	0.193	0.571	0.004
Rv3014c.2	16	2zva_1N1_A_513 PDB CREDO	0.641	0.134	0.571	0.004
Rv3014c.2	16	1kij_NOV_B_444 PDB CREDO	0.591	0.190	0.569	0.004
Rv3014c.2	6	3bjw_SVR_E_503 PDB CREDO	0.584	0.199	0.568	0.004
Rv3014c.2	6	3gcs_BAX_A_401 PDB CREDO	0.704	0.078	0.562	0.004
Rv3014c.2	31	1xkk_FMM_A_91 PDB CREDO	0.643	0.132	0.562	0.004
Rv3014c.2	2	1hwk_117_B_1 PDB CREDO	0.611	0.165	0.560	0.004
Rv3014c.2	2	3frq_ERY_A_195 PDB CREDO	0.591	0.190	0.557	0.004
Rv3014c.2	2	3ut5_LOC_B_502 PDB CREDO	0.573	0.213	0.556	0.005
Rv3014c.2	2	1z2b_VLB_C_800 PDB CREDO	0.555	0.236	0.555	0.005
Rv3014c.2	16	1kij_NOV_A_400 PDB CREDO	0.662	0.113	0.554	0.005
Rv3014c.2	16	3oht_1N1_B_1000 PDB CREDO	0.618	0.158	0.554	0.005
Rv3014c.2	31	1uwj_BAX_B_1723 PDB CREDO	0.638	0.136	0.553	0.005
Rv3014c.2	6	2qxs_RAL_A_600 PDB CREDO	0.583	0.200	0.553	0.005
Rv3014c.2	6	3cs9_NIL_C_600 PDB CREDO	0.551	0.243	0.551	0.005
Rv3014c.2	6	2qxs_RAL_B_600 PDB CREDO	0.581	0.203	0.550	0.005
Rv3014c.2	16	2cbr_A80_A_201 PDB CREDO	0.548	0.247	0.548	0.005
Rv3014c.2	16	2pgf_ADN_A_501 PDB CREDO	0.547	0.248	0.547	0.005
Rv3014c.2	16	2y7j_B49_B_1294 PDB CREDO	0.638	0.136	0.546	0.005
Rv3014c.2	6	3cs9_NIL_D_600 PDB CREDO	0.545	0.251	0.545	0.005
Rv3014c.2	2	3d91_REM_A_350 PDB CREDO	0.561	0.228	0.545	0.005
Rv3014c.2	16	2fum_MIX_A_539 PDB CREDO	0.586	0.197	0.544	0.006
Rv3014c.2	31	1opj_STI_A_3 PDB CREDO	0.543	0.253	0.543	0.006
Rv3014c.2	6	3sm2_478_A_126 PDB CREDO	0.602	0.176	0.543	0.006
Rv3014c.2	16	3k54_1N1_A_1 PDB CREDO	0.563	0.227	0.542	0.006
Rv3014c.2	6	1uwj_BAX_A_1723 PDB CREDO	0.621	0.154	0.542	0.006
Rv3014c.2	22	4dta_ADN_A_401 PDB CREDO	0.697	0.083	0.541	0.006
Rv3014c.2	31	1opj_STI_B_4 PDB CREDO	0.541	0.257	0.541	0.006
Rv3014c.2	2	1hwi_115_B_1 PDB CREDO	0.593	0.188	0.540	0.006
Rv3014c.2	16	2fum_MIX_D_3539 PDB CREDO	0.646	0.129	0.540	0.006
Rv3014c.2	31	4asd_BAX_A_1500 PDB CREDO	0.623	0.153	0.540	0.006
Rv3014c.2	6	3cs9_NIL_B_600 PDB CREDO	0.569	0.219	0.539	0.006
Rv3014c.2	6	3bjw_SVR_B_501 PDB CREDO	0.567	0.220	0.538	0.006
Rv3014c.2	2	3ut5_LOC_D_502 PDB CREDO	0.590	0.191	0.538	0.006
Rv3014c.2	6	3b0w_DGX_B_1 PDB CREDO	0.600	0.179	0.538	0.006
Rv3014c.2	2	2nni_MTK_A_501 PDB CREDO	0.570	0.217	0.537	0.006
Rv3014c.2	2	3d91_REM_B_350 PDB CREDO	0.553	0.240	0.537	0.006
Rv3014c.2	31	3bjw_SVR_E_503 PDB CREDO	0.567	0.221	0.537	0.006
Rv3014c.2	2	3frq_ERY_B_195 PDB CREDO	0.588	0.193	0.536	0.006
Rv3014c.2	6	3cs9_NIL_A_600 PDB CREDO	0.581	0.202	0.536	0.006
Rv3014c.2	22	2y7j_B49_B_1294 PDB CREDO	0.558	0.234	0.536	0.006
Rv3014c.2	31	3k5v_STI_A_2 PDB CREDO	0.550	0.243	0.535	0.006
Rv3014c.2	2	1hwi_115_D_3 PDB CREDO	0.587	0.195	0.535	0.006
Rv3014c.2	31	3b0w_DGX_B_1 PDB CREDO	0.549	0.245	0.534	0.006
Rv3014c.2	2	3tkd_CYZ_B_267 PDB CREDO	0.550	0.244	0.533	0.007
Rv3014c.2	31	3pyy_STI_A_3 PDB CREDO	0.580	0.204	0.533	0.007
Rv3014c.2	16	3o1c_ADN_A_127 PDB CREDO	0.553	0.240	0.533	0.007
Rv3014c.2	6	1hwk_117_B_1 PDB CREDO	0.628	0.147	0.532	0.007
Rv3014c.2	2	1uwj_BAX_A_1723 PDB CREDO	0.597	0.182	0.532	0.007
Rv3014c.2	2	3tne_RIT_A_401 PDB CREDO	0.581	0.202	0.530	0.007
Rv3014c.2	31	3ms9_STI_A_1 PDB CREDO	0.577	0.208	0.530	0.007
Rv3014c.2	31	3gp0_NIL_A_1 PDB CREDO	0.590	0.191	0.530	0.007
Rv3014c.2	6	4asd_BAX_A_1500 PDB CREDO	0.662	0.113	0.529	0.007
Rv3014c.2	31	1iep_STI_B_202 PDB CREDO	0.576	0.209	0.529	0.007
Rv3014c.2	31	3ms9_STI_B_1 PDB CREDO	0.576	0.209	0.529	0.007
Rv3014c.2	6	3spk_TPV_B_100 PDB CREDO	0.642	0.132	0.529	0.007
Rv3014c.2	31	3cs9_NIL_A_600 PDB CREDO	0.529	0.275	0.529	0.007
Rv3014c.2	2	1uwj_BAX_B_1723 PDB CREDO	0.545	0.252	0.529	0.007
Rv3014c.2	6	3bjw_SVR_H_504 PDB CREDO	0.557	0.234	0.528	0.007
Rv3014c.2	16	1z9y_FUN_A_500 PDB CREDO	0.549	0.246	0.528	0.007
Rv3014c.2	2	1hwi_115_A_2 PDB CREDO	0.638	0.136	0.528	0.007
Rv3014c.2	31	3mss_STI_A_1 PDB CREDO	0.575	0.211	0.528	0.007
Rv3014c.2	22	3r9c_ECL_A_452 PDB CREDO	0.597	0.183	0.528	0.007
Rv3014c.2	31	3oez_STI_A_601 PDB CREDO	0.574	0.211	0.528	0.007
Rv3014c.2	31	1uwh_BAX_A_1723 PDB CREDO	0.646	0.128	0.527	0.007
Rv3014c.2	31	3mss_STI_C_1 PDB CREDO	0.574	0.212	0.527	0.007
Rv3014c.2	31	3mss_STI_D_1 PDB CREDO	0.574	0.212	0.527	0.007
Rv3014c.2	6	3heg_BAX_A_1 PDB CREDO	0.680	0.097	0.527	0.007
Rv3014c.2	31	1iep_STI_A_201 PDB CREDO	0.573	0.212	0.527	0.007
Rv3014c.2	31	2hyy_STI_D_600 PDB CREDO	0.573	0.212	0.527	0.007
Rv3014c.2	31	3mss_STI_B_1 PDB CREDO	0.573	0.212	0.527	0.007
Rv3014c.2	16	1d4f_ADN_B_602 PDB CREDO	0.527	0.277	0.527	0.007
Rv3014c.2	31	3tne_RIT_A_401 PDB CREDO	0.687	0.091	0.527	0.007
Rv3014c.2	16	3qgz_ADN_A_127 PDB CREDO	0.546	0.249	0.527	0.007
Rv3014c.2	22	2ity_IRE_A_2020 PDB CREDO	0.526	0.278	0.526	0.007
Rv3014c.2	31	1uwh_BAX_B_1723 PDB CREDO	0.645	0.130	0.526	0.007
Rv3014c.2	31	2hyy_STI_A_600 PDB CREDO	0.573	0.213	0.526	0.007
Rv3014c.2	16	1d4f_ADN_D_604 PDB CREDO	0.526	0.278	0.526	0.007
Rv3014c.2	6	3bjw_SVR_F_502 PDB CREDO	0.554	0.238	0.526	0.007
Rv3014c.2	2	1uwh_BAX_A_1723 PDB CREDO	0.542	0.255	0.526	0.007
Rv3014c.2	31	3k5v_STI_B_2 PDB CREDO	0.572	0.214	0.526	0.007
Rv3014c.2	31	3pyy_STI_B_4 PDB CREDO	0.572	0.214	0.526	0.007
Rv3014c.2	2	1uwh_BAX_B_1723 PDB CREDO	0.542	0.256	0.526	0.007
Rv3014c.2	31	2hyy_STI_C_600 PDB CREDO	0.572	0.214	0.525	0.007
Rv3014c.2	31	3gvu_STI_A_1001 PDB CREDO	0.571	0.216	0.524	0.008
Rv3014c.2	31	3nxu_RIT_B_600 PDB CREDO	0.539	0.260	0.524	0.008
Rv3014c.2	16	2fum_MIX_B_1539 PDB CREDO	0.612	0.165	0.524	0.008
Rv3014c.2	31	2qxs_RAL_A_600 PDB CREDO	0.538	0.261	0.523	0.008
Rv3014c.2	22	1d4f_ADN_A_601 PDB CREDO	0.523	0.283	0.523	0.008
Rv3014c.2	16	1s9p_DES_B_459 PDB CREDO	0.587	0.195	0.523	0.008
Rv3014c.2	22	3g5d_1N1_B_1 PDB CREDO	0.544	0.253	0.523	0.008
Rv3014c.2	31	2qxs_RAL_B_600 PDB CREDO	0.537	0.263	0.522	0.008
Rv3014c.2	31	3nxu_RIT_A_600 PDB CREDO	0.536	0.264	0.522	0.008
Rv3014c.2	2	3tne_RIT_B_401 PDB CREDO	0.572	0.214	0.521	0.008
Rv3014c.2	2	3q70_RIT_A_2001 PDB CREDO	0.521	0.286	0.521	0.008
Rv3014c.2	22	2zva_1N1_A_513 PDB CREDO	0.521	0.286	0.521	0.008
Rv3014c.2	16	2uxo_TAC_B_1211 PDB CREDO	0.608	0.169	0.521	0.008
Rv3014c.2	16	3kw2_ADN_B_300 PDB CREDO	0.584	0.198	0.521	0.008
Rv3014c.2	22	3qlg_1N1_A_601 PDB CREDO	0.541	0.256	0.520	0.008
Rv3014c.2	6	2q64_1UN_B_1001 PDB CREDO	0.591	0.190	0.520	0.008
Rv3014c.2	31	3cs9_NIL_D_600 PDB CREDO	0.564	0.225	0.520	0.008
Rv3014c.2	6	2qak_1UN_A_1001 PDB CREDO	0.589	0.192	0.519	0.008
Rv3014c.2	22	1ie4_T44_A_128 PDB CREDO	0.562	0.227	0.518	0.008
Rv3014c.2	6	3el9_DR7_A_100 PDB CREDO	0.532	0.270	0.518	0.008
Rv3014c.2	6	3ufn_ROC_A_401 PDB CREDO	0.532	0.270	0.518	0.008
Rv3014c.2	6	1c6y_MK1_B_524 PDB CREDO	0.532	0.270	0.518	0.008
Rv3014c.2	2	3tkd_CYZ_A_266 PDB CREDO	0.567	0.220	0.517	0.008
Rv3014c.2	22	3qlg_1N1_B_601 PDB CREDO	0.538	0.261	0.517	0.008
Rv3014c.2	6	2q63_1UN_A_1001 PDB CREDO	0.588	0.194	0.517	0.008
Rv3014c.2	31	3cs9_NIL_C_600 PDB CREDO	0.561	0.229	0.517	0.008
Rv3014c.2	31	2xkw_P1B_A_1478 PDB CREDO	0.606	0.172	0.517	0.008
Rv3014c.2	16	1g50_EST_A_600 PDB CREDO	0.603	0.175	0.516	0.008
Rv3014c.2	16	3r9c_ECL_A_452 PDB CREDO	0.655	0.119	0.516	0.008
Rv3014c.2	6	2pyn_1UN_A_1001 PDB CREDO	0.587	0.195	0.516	0.009
Rv3014c.2	6	1opj_STI_A_3 PDB CREDO	0.559	0.231	0.516	0.009
Rv3014c.2	6	1opj_STI_B_4 PDB CREDO	0.559	0.231	0.516	0.009
Rv3014c.2	6	2pym_1UN_A_1001 PDB CREDO	0.586	0.196	0.516	0.009
Rv3014c.2	16	1s9p_DES_A_459 PDB CREDO	0.575	0.210	0.516	0.009
Rv3014c.2	2	1sa1_POD_D_701 PDB CREDO	0.516	0.294	0.516	0.009
Rv3014c.2	31	3tne_RIT_B_401 PDB CREDO	0.672	0.104	0.515	0.009
Rv3014c.2	16	1s9p_DES_C_500 PDB CREDO	0.578	0.206	0.515	0.009
Rv3014c.2	16	3ols_EST_A_600 PDB CREDO	0.602	0.177	0.515	0.009
Rv3014c.2	6	1c6z_ROC_B_505 PDB CREDO	0.585	0.197	0.515	0.009
Rv3014c.2	16	1ki3_PE2_A_1 PDB CREDO	0.577	0.207	0.514	0.009
Rv3014c.2	31	3cs9_NIL_B_600 PDB CREDO	0.529	0.275	0.514	0.009
Rv3014c.2	2	1uob_PNN_A_1311 PDB CREDO	0.514	0.297	0.514	0.009
Rv3014c.2	16	2gqg_1N1_A_501 PDB CREDO	0.553	0.240	0.514	0.009
Rv3014c.2	16	3ols_EST_B_600 PDB CREDO	0.600	0.179	0.514	0.009
Rv3014c.2	6	3ogq_AB1_A_200 PDB CREDO	0.555	0.237	0.513	0.009
Rv3014c.2	16	2yja_EST_B_1550 PDB CREDO	0.599	0.180	0.513	0.009
Rv3014c.2	6	1uob_PNN_A_1311 PDB CREDO	0.661	0.114	0.513	0.009
Rv3014c.2	31	3d91_REM_A_350 PDB CREDO	0.591	0.190	0.513	0.009
Rv3014c.2	16	3uud_EST_A_600 PDB CREDO	0.598	0.181	0.512	0.009
Rv3014c.2	22	2itz_IRE_A_2021 PDB CREDO	0.533	0.268	0.512	0.009
Rv3014c.2	22	3g5d_1N1_A_1 PDB CREDO	0.533	0.269	0.512	0.009
Rv3014c.2	2	1sa1_POD_B_700 PDB CREDO	0.527	0.277	0.512	0.009
Rv3014c.2	16	3uud_EST_B_600 PDB CREDO	0.598	0.182	0.512	0.009
Rv3014c.2	16	2xkw_P1B_B_1475 PDB CREDO	0.550	0.244	0.511	0.009
Rv3014c.2	31	1hwk_117_B_1 PDB CREDO	0.555	0.237	0.510	0.009
Rv3014c.2	22	1kij_NOV_B_444 PDB CREDO	0.551	0.242	0.510	0.009
Rv3014c.2	31	2hyy_STI_B_600 PDB CREDO	0.605	0.173	0.509	0.010
Rv3014c.2	31	3el9_DR7_A_100 PDB CREDO	0.537	0.263	0.508	0.010
Rv3014c.2	31	1uob_PNN_A_1311 PDB CREDO	0.604	0.174	0.508	0.010
Rv3014c.2	16	2ito_IRE_A_2020 PDB CREDO	0.527	0.277	0.507	0.010
Rv3014c.2	16	3lfa_1N1_A_361 PDB CREDO	0.644	0.131	0.507	0.010
Rv3014c.2	6	1n49_RIT_B_301 PDB CREDO	0.549	0.245	0.507	0.010
Rv3014c.2	31	3d91_REM_B_350 PDB CREDO	0.584	0.199	0.506	0.010
Rv3014c.2	16	4dta_ADN_A_401 PDB CREDO	0.730	0.059	0.505	0.010
Rv3014c.2	16	1a4l_DCF_A_353 PDB CREDO	0.543	0.254	0.505	0.010
Rv3014c.2	16	1a4l_DCF_C_1353 PDB CREDO	0.543	0.254	0.505	0.010
Rv3014c.2	2	1lhv_NOG_A_301 PDB CREDO	0.571	0.216	0.504	0.010
Rv3014c.2	16	1a4l_DCF_B_853 PDB CREDO	0.542	0.255	0.504	0.010
Rv3014c.2	16	1a4l_DCF_D_1853 PDB CREDO	0.542	0.255	0.504	0.010
Rv3014c.2	6	3oez_STI_A_601 PDB CREDO	0.594	0.186	0.504	0.010
Rv3014c.2	22	3oht_1N1_A_1000 PDB CREDO	0.565	0.224	0.503	0.010
Rv3014c.2	6	1n49_RIT_D_401 PDB CREDO	0.593	0.188	0.502	0.011
Rv3014c.2	6	1uwj_BAX_B_1723 PDB CREDO	0.629	0.146	0.502	0.011
Rv3014c.2	22	1sn5_T3_C_601 PDB CREDO	0.567	0.220	0.502	0.011
Rv3014c.2	16	1d4f_ADN_A_601 PDB CREDO	0.563	0.226	0.502	0.011
Rv3014c.2	16	3oct_1N1_A_663 PDB CREDO	0.579	0.206	0.501	0.011
Rv3014c.2	31	3tkd_CYZ_B_267 PDB CREDO	0.614	0.163	0.501	0.011
Rv3014c.2	6	1sa1_POD_B_700 PDB CREDO	0.626	0.149	0.501	0.011
Rv3014c.2	31	3pww_ROC_A_1001 PDB CREDO	0.543	0.254	0.501	0.011
Rv3014c.2	31	2vn1_FK5_A_501 PDB CREDO	0.500	0.318	0.500	0.011
Rv3014c.2	31	3bjw_SVR_B_501 PDB CREDO	0.572	0.215	0.500	0.011

Similarity to known drug target from sensitive sequence analysis

No drug targets

List of small molecules tested from TIBLE

Data not available

Off-target activity - ligand based from TIBLE

Data not available

Small molecules involved in protein-protein complex from TIMBAL .Proteins similar to Mtb based on sequence analysis.

Data not available

STITCH interactions

Chemical Name	Confidence score	Molecular Weight
NAD+PubChem	0.997	663.425
adenosine monophosphatePubChem	0.996	347.221
nicotinamide nucleotidePubChem	0.989	335.227
alpha-NMNPubChem	0.9	335.227
glycerolPubChem	0.8	92.0938
sulfatePubChem	0.798	96.0626
hydron sulfatePubChem	0.798	196.157
phosphatePubChem	0.793	96.9872
N-substituted tetracyclic indolePubChem	0.793	418.637
3B9PubChem	0.787	428.486
zincPubChem	0.736	65.409
uracilPubChem	0.729	112.087
Na(+)PubChem	0.712	22.9898
hydron diphosphatePubChem	0.7	391.981