SInCRe - Rv0500

Tuberculist information

Gene name	proC
Protein function	Probable pyrroline-5-carboxylate reductase ProC (P5CR) (P5C reductase)
Functional category(tuberculist)	intermediary metabolism and respiration
Gene location(kb)	590.083
Molecular mass(da)	30171.6
External sites	TB Database TubercuList WebTB

Protein sequence

Number of amino acids : 295

	  		  	1    MLFGMARIAIIGGGSIGEALLSGLLRAGRQVKDLVVAERMPDRANYLAQTYSVLVTSAAD   60
			  	61   AVENATFVVVAVKPADVEPVIADLANATAAAENDSAEQVFVTVVAGITIAYFESKLPAGT  120
			  	121  PVVRAMPNAAALVGAGVTALAKGRFVTPQQLEEVSALFDAVGGVLTVPESQLDAVTAVSG  180
			  	181  SGPAYFFLLVEALVDAGVGVGLSRQVATDLAAQTMAGSAAMLLERMEQDQGGANGELMGL  240
			  	241  RVDLTASRLRAAVTSPGGTTAAALRELERGGFRMAVDAAVQAAKSRSEQLRITPE

Known structures in the PDB

No Known structures

Number of amino acids : 295

Domains assigned based on sequence.

Mtb Structural proteome models

CHOPIN models

Profile-based domain assignment

Structural/Functional domain family	Pfam acc.no./SCOP ID	Domain Region
F420_oxidored	PF03807	7-106
P5CR_dimer	PF14748	167-290

Mtb Structural Proteome models

Model Number	1
Model name	Rv0500A
Template	1Z4H APDB CREDO
Template coverage	4_64
Template Identity(%)	16.7
Model coverage(%)	74.7
Normalized DOPE score	0.325

Model Number	2
Model name	Rv0500
Template	2AHR APDB CREDO
Template coverage	2_256
Template Identity(%)	31.8
Model coverage(%)	95.9
Normalized DOPE score	0.51

Structure Models from Chopin

Model Number	1
Profile	1.10.3730.10 Click for model details
zscore	31.01
Residue begin	168
Residue end	291

Binding pockets

STRING

Cytoscape Web will replace the contents of this div with protein-protein interaction network.

Protein interacting with Rv0500	Gene name	Confidence Score
Rv2427c	proA	0.998
Rv2439c	proB	0.966
Rv2439c	proB	0.966
Rv1605	hisF	0.962
Rv1603	hisA	0.952
Rv1599	hisD	0.943
Rv1188	Rv1188	0.937
Rv1601	hisB	0.937
Rv3356c	folD	0.933
Rv3356c	folD	0.933
Rv1187	rocA	0.927
Rv1658	argG	0.919
Rv3708c	asd	0.916
Rv3708c	asd	0.916

Potential ligand/drug binding sites

Protein Model	Pocket Number	Drug Binding Site	PMIN Score	Pvalue PMIN	PMAX Score	Pvalue PMAX
Rv0500A	4	3rem_SAL_B_301 PDB CREDO	0.768	0.038	0.605	0.002
Rv0500A	4	3rem_SAL_A_301 PDB CREDO	0.753	0.046	0.593	0.002
Rv0500A	1	3s20_CER_B_1 PDB CREDO	0.615	0.162	0.585	0.003
Rv0500A	4	1g50_EST_B_1600 PDB CREDO	0.612	0.165	0.585	0.003
Rv0500A	4	3hm1_J3Z_A_2 PDB CREDO	0.608	0.170	0.581	0.003
Rv0500A	4	1qku_EST_B_600 PDB CREDO	0.607	0.171	0.580	0.003
Rv0500A	4	1ere_EST_A_600 PDB CREDO	0.605	0.173	0.578	0.003
Rv0500A	4	1ere_EST_E_600 PDB CREDO	0.605	0.173	0.578	0.003
Rv0500A	4	1qku_EST_C_600 PDB CREDO	0.605	0.173	0.578	0.003
Rv0500A	4	1ere_EST_B_600 PDB CREDO	0.604	0.175	0.577	0.003
Rv0500A	4	1qku_EST_A_600 PDB CREDO	0.604	0.175	0.577	0.003
Rv0500A	4	1pcg_EST_B_2 PDB CREDO	0.596	0.184	0.570	0.004
Rv0500A	1	3s20_CER_A_1 PDB CREDO	0.597	0.182	0.568	0.004
Rv0500A	4	3ols_EST_B_600 PDB CREDO	0.701	0.080	0.567	0.004
Rv0500A	4	3ols_EST_A_600 PDB CREDO	0.700	0.081	0.566	0.004
Rv0500A	4	3rf4_FUN_C_203 PDB CREDO	0.717	0.069	0.565	0.004
Rv0500A	4	1g50_EST_C_2600 PDB CREDO	0.616	0.160	0.564	0.004
Rv0500A	4	2j7x_EST_A_1454 PDB CREDO	0.615	0.161	0.563	0.004
Rv0500A	4	1g50_EST_A_600 PDB CREDO	0.697	0.083	0.563	0.004
Rv0500A	4	3rf4_FUN_B_202 PDB CREDO	0.713	0.071	0.562	0.004
Rv0500A	4	2uxp_CLM_B_1211 PDB CREDO	0.586	0.197	0.560	0.004
Rv0500A	4	1ere_EST_C_600 PDB CREDO	0.610	0.167	0.559	0.004
Rv0500A	4	1ere_EST_F_600 PDB CREDO	0.610	0.167	0.559	0.004
Rv0500A	4	3rf4_FUN_A_201 PDB CREDO	0.709	0.074	0.559	0.004
Rv0500A	4	1a52_EST_B_2 PDB CREDO	0.609	0.168	0.558	0.004
Rv0500A	4	3hm1_J3Z_B_1 PDB CREDO	0.609	0.168	0.558	0.004
Rv0500A	4	3lfa_1N1_A_361 PDB CREDO	0.635	0.139	0.558	0.004
Rv0500A	1	2x7h_PFN_A_1372 PDB CREDO	0.613	0.163	0.557	0.004
Rv0500A	4	1ere_EST_D_600 PDB CREDO	0.608	0.169	0.557	0.004
Rv0500A	4	1pcg_EST_A_1 PDB CREDO	0.608	0.169	0.557	0.004
Rv0500A	4	3uud_EST_A_600 PDB CREDO	0.689	0.089	0.557	0.004
Rv0500A	4	1gwr_EST_A_600 PDB CREDO	0.582	0.201	0.557	0.004
Rv0500A	4	1a52_EST_A_1 PDB CREDO	0.607	0.171	0.556	0.005
Rv0500A	4	2ocf_EST_A_596 PDB CREDO	0.607	0.171	0.556	0.005
Rv0500A	4	3oll_EST_A_600 PDB CREDO	0.607	0.171	0.556	0.005
Rv0500A	4	3uud_EST_B_600 PDB CREDO	0.688	0.090	0.556	0.005
Rv0500A	4	1gwr_EST_B_600 PDB CREDO	0.581	0.202	0.556	0.005
Rv0500A	4	1qkt_EST_A_600 PDB CREDO	0.606	0.172	0.555	0.005
Rv0500A	4	3oll_EST_B_600 PDB CREDO	0.606	0.172	0.555	0.005
Rv0500A	4	2bxp_P1Z_A_3001 PDB CREDO	0.608	0.170	0.555	0.005
Rv0500A	4	2yja_EST_B_1550 PDB CREDO	0.683	0.095	0.552	0.005
Rv0500A	1	3rf4_FUN_C_203 PDB CREDO	0.579	0.204	0.551	0.005
Rv0500A	4	3ret_SAL_B_201 PDB CREDO	0.818	0.019	0.551	0.005
Rv0500A	1	3rf4_FUN_A_201 PDB CREDO	0.577	0.208	0.549	0.005
Rv0500A	1	3ilt_TRU_E_800 PDB CREDO	0.548	0.247	0.548	0.005
Rv0500A	1	3rf4_FUN_B_202 PDB CREDO	0.573	0.213	0.545	0.005
Rv0500A	1	2jih_097_A_1001 PDB CREDO	0.572	0.214	0.544	0.006
Rv0500A	4	1jlb_NVP_A_999 PDB CREDO	0.543	0.253	0.543	0.006
Rv0500A	4	3ret_SAL_A_201 PDB CREDO	0.808	0.022	0.543	0.006
Rv0500A	1	2w03_ADN_A_1588 PDB CREDO	0.633	0.142	0.543	0.006
Rv0500A	4	2uxp_CLM_A_1211 PDB CREDO	0.567	0.221	0.541	0.006
Rv0500A	4	3hgx_SAL_B_104 PDB CREDO	0.796	0.026	0.535	0.006
Rv0500A	4	1sn0_T44_C_601 PDB CREDO	0.533	0.268	0.533	0.007
Rv0500A	1	2uxp_CLM_B_1211 PDB CREDO	0.615	0.162	0.533	0.007
Rv0500A	4	1s9p_DES_C_500 PDB CREDO	0.685	0.093	0.532	0.007
Rv0500A	4	2x7h_PFN_A_1372 PDB CREDO	0.583	0.201	0.531	0.007
Rv0500A	1	4dta_ADN_A_401 PDB CREDO	0.640	0.134	0.530	0.007
Rv0500A	4	1s9p_DES_B_459 PDB CREDO	0.683	0.095	0.530	0.007
Rv0500A	4	3hgx_SAL_A_102 PDB CREDO	0.784	0.031	0.527	0.007
Rv0500A	4	2bxd_RWF_A_2001 PDB CREDO	0.522	0.284	0.522	0.008
Rv0500A	1	3r9c_ECL_A_452 PDB CREDO	0.713	0.071	0.519	0.008
Rv0500A	1	1sn0_T44_B_602 PDB CREDO	0.574	0.212	0.518	0.008
Rv0500A	4	3b2r_VDN_B_1 PDB CREDO	0.517	0.292	0.517	0.008
Rv0500A	1	1uay_ADN_A_1001 PDB CREDO	0.594	0.186	0.515	0.009
Rv0500A	1	3rem_SAL_A_301 PDB CREDO	0.540	0.259	0.513	0.009
Rv0500A	4	3b2r_VDN_A_1 PDB CREDO	0.511	0.301	0.511	0.009
Rv0500A	4	1uay_ADN_A_1001 PDB CREDO	0.534	0.267	0.510	0.009
Rv0500A	1	2xn3_ID8_A_1356 PDB CREDO	0.662	0.113	0.509	0.010
Rv0500A	1	2uxp_CLM_A_1211 PDB CREDO	0.585	0.197	0.507	0.010
Rv0500A	1	3mg0_BO2_K_1402 PDB CREDO	0.590	0.191	0.506	0.010
Rv0500A	1	3mg0_BO2_Y_1403 PDB CREDO	0.589	0.193	0.505	0.010
Rv0500A	1	2f16_BO2_K_1402 PDB CREDO	0.587	0.194	0.504	0.010
Rv0500A	4	3ug2_IRE_A_1 PDB CREDO	0.607	0.170	0.503	0.010
Rv0500A	1	2f16_BO2_Y_1403 PDB CREDO	0.586	0.196	0.502	0.011
Rv0500A	1	2oa1_ADN_B_2005 PDB CREDO	0.586	0.196	0.502	0.011
Rv0500A	1	3ik6_HCZ_B_800 PDB CREDO	0.528	0.275	0.502	0.011
Rv0500A	4	2bxg_IBP_B_2001 PDB CREDO	0.548	0.246	0.502	0.011
Rv0500A	4	3pgh_FLP_B_701 PDB CREDO	0.525	0.280	0.502	0.011
Rv0500A	4	1pbc_BHA_A_396 PDB CREDO	0.501	0.317	0.501	0.011

Similarity to known drug target from sensitive sequence analysis

No drug targets

List of small molecules tested from TIBLE

Data not available

Off-target activity - ligand based from TIBLE

Data not available

Small molecules involved in protein-protein complex from TIMBAL .Proteins similar to Mtb based on sequence analysis.

Data not available

STITCH interactions

Chemical Name	Confidence score	Molecular Weight
pyrroline-5-carboxylatePubChem	0.985	113.115
L-prolinePubChem	0.981	115.13
1-pyrroline-5-carboxylatePubChem	0.977	113.115
glutamate semialdehydePubChem	0.956	131.13
glutamate gamma-semialdehydePubChem	0.941	131.13
hydroxyl radicalsPubChem	0.9	17.0073
deuteriumPubChem	0.9	2.01588
H(+)PubChem	0.9	2.01588
C04281PubChem	0.9	129.114
protiumPubChem	0.9	2.01576
NADPPubChem	0.864	744.413
selenomethioninePubChem	0.772	196.106
SeMetPubChem	0.772	196.106
ornithinePubChem	0.721	132.161