SInCRe - Rv1601

Tuberculist information

Gene name	hisB
Protein function	Probable imidazole glycerol-phosphate dehydratase HisB
Functional category(tuberculist)	intermediary metabolism and respiration
Gene location(kb)	1802.04
Molecular mass(da)	22769.6
External sites	TB Database TubercuList WebTB

Protein sequence

Number of amino acids : 210

	  		  	1    MTTTQTAKASRRARIERRTRESDIVIELDLDGTGQVAVDTGVPFYDHMLTALGSHASFDL   60
			  	61   TVRATGDVEIEAHHTIEDTAIALGTALGQALGDKRGIRRFGDAFIPMDETLAHAAVDLSG  120
			  	121  RPYCVHTGEPDHLQHTTIAGSSVPYHTVINRHVFESLAANARIALHVRVLYGRDPHHITE  180
			  	181  AQYKAVARALRQAVEPDPRVSGVPSTKGAL

Known structures in the PDB

	PDB ID	4GQU
	Total residue count	216
	Number of chains	1
	Method	X-RAY
	Resolution	2.02

	PDB ID	4LOM
	Total residue count	216
	Number of chains	1
	Method	X-RAY
	Resolution	2.1

	PDB ID	4LPF
	Total residue count	216
	Number of chains	1
	Method	X-RAY
	Resolution	2.3

Number of amino acids : 210

Domains assigned based on sequence.

Mtb Structural proteome models

CHOPIN models

Profile-based domain assignment

Structural/Functional domain family	Pfam acc.no./SCOP ID	Domain Region
IGPD	PF00475	40-191

Mtb Structural Proteome models

Model Number	1
Model name	Rv1601
Template	2F1D APDB CREDO
Template coverage	11_192
Template Identity(%)	50.5
Model coverage(%)	89.5
Normalized DOPE score	-1.257

Structure Models from Chopin

Model Number	1
Profile	d.14.1.9 Click for model details
zscore	19.1
Residue begin	95
Residue end	201

Binding pockets

STRING

Cytoscape Web will replace the contents of this div with protein-protein interaction network.

Protein interacting with Rv1601	Gene name	Confidence Score
Rv1605	hisF	0.999
Rv1606	hisI	0.999
Rv1599	hisD	0.999
Rv1600	hisC1	0.999
Rv1602	hisH	0.999
Rv1603	hisA	0.999
Rv3772	hisC2	0.995
Rv2121c	hisG	0.994
Rv2121c	hisG	0.994
Rv0114	gmhB	0.968
Rv1609	trpE	0.951
Rv1609	trpE	0.951
Rv1612	trpB	0.948
Rv0500	proC	0.937
Rv0500	proC	0.937
Rv1611	trpC	0.932
Rv3042c	serB2	0.914
Rv3396c	guaA	0.914
Rv3396c	guaA	0.914
Rv3396c	guaA	0.914
Rv3042c	serB2	0.914
Rv2192c	trpD	0.908
Rv2192c	trpD	0.908
Rv2580c	hisS	0.908
Rv2580c	hisS	0.908

Potential ligand/drug binding sites

No binding sites identified

Similarity to known drug target from sensitive sequence analysis

No drug targets

List of small molecules tested from TIBLE

Data not available

Off-target activity - ligand based from TIBLE

Data not available

Small molecules involved in protein-protein complex from TIMBAL .Proteins similar to Mtb based on sequence analysis.

Data not available

STITCH interactions

Chemical Name	Confidence score	Molecular Weight
histidinol phosphatePubChem	0.978	221.151
histidinolPubChem	0.972	141.171
histidinol-phosphatePubChem	0.962	221.151
HSOPubChem	0.957	139.155
phosphatePubChem	0.957	96.9872
L-histidinolPubChem	0.945	141.171
imidazole glycerol phosphatePubChem	0.937	238.135
imidazole acetol phosphatePubChem	0.93	220.12
glutamatePubChem	0.9	147.129
glutaminPubChem	0.9	146.145
NAD+PubChem	0.9	663.425
Chebi:17805PubChem	0.9	238.135
H(+)PubChem	0.9	2.01588
hydroxyl radicalsPubChem	0.9	17.0073
dihydronicotinamide formycin dinucleotidePubChem	0.9	665.441
PRFARPubChem	0.9	577.331
aminoimidazole carboxamide ribonucleotidePubChem	0.9	338.211
NSC292227PubChem	0.9	338.211
polyglutaminePubChem	0.9	146.145
histidinalPubChem	0.9	139.155
reduced nicotinamide adenine dinucleotidePubChem	0.9	665.441
protiumPubChem	0.9	2.01576
alpha-ketoglutaratePubChem	0.9	146.098
deuteriumPubChem	0.9	2.01588
phosphoribulosylformimino-AICAR-PPubChem	0.9	577.331
5-aminoimidazole-4-carboxamide ribosidePubChem	0.9	338.211
magnesiumPubChem	0.812	24.305
hydron sulfatePubChem	0.786	196.157
sulfatePubChem	0.786	96.0626
D-glycero-D-manno-heptose-1,7-bisphosphatePubChem	0.776	370.142
L-glycero-D-manno-heptosePubChem	0.772	210.182
heptosePubChem	0.761	210.182
glycerolPubChem	0.735	92.0938
acetatePubChem	0.721	59.044