SInCRe - Rv1611

Tuberculist information

Gene name	trpC
Protein function	Probable indole-3-glycerol phosphate synthase TrpC
Functional category(tuberculist)	intermediary metabolism and respiration
Gene location(kb)	1810.24
Molecular mass(da)	28023.1
External sites	TB Database TubercuList WebTB

Protein sequence

Number of amino acids : 272

	  		  	1    MSPATVLDSILEGVRADVAAREASVSLSEIKAAAAAAPPPLDVMAALREPGIGVIAEVKR   60
			  	61   ASPSAGALATIADPAKLAQAYQDGGARIVSVVTEQRRFQGSLDDLDAVRASVSIPVLRKD  120
			  	121  FVVQPYQIHEARAHGADMLLLIVAALEQSVLVSMLDRTESLGMTALVEVHTEQEADRALK  180
			  	181  AGAKVIGVNARDLMTLDVDRDCFARIAPGLPSSVIRIAESGVRGTADLLAYAGAGADAVL  240
			  	241  VGEGLVTSGDPRAAVADLVTAGTHPSCPKPAR

Known structures in the PDB

	PDB ID	3QJA
	Total residue count	272
	Number of chains	1
	Method	X-RAY
	Resolution	1.29

	PDB ID	3T40
	Total residue count	272
	Number of chains	1
	Method	X-RAY
	Resolution	1.75

	PDB ID	3T44
	Total residue count	272
	Number of chains	1
	Method	X-RAY
	Resolution	1.6

	PDB ID	3T55
	Total residue count	272
	Number of chains	1
	Method	X-RAY
	Resolution	2.06

	PDB ID	3T78
	Total residue count	272
	Number of chains	1
	Method	X-RAY
	Resolution	1.6

	PDB ID	4FB7
	Total residue count	275
	Number of chains	1
	Method	X-RAY
	Resolution	1.3

Number of amino acids : 272

Domains assigned based on sequence.

Mtb Structural proteome models

CHOPIN models

Profile-based domain assignment

Structural/Functional domain family	Pfam acc.no./SCOP ID	Domain Region
IGPS	PF00218	7-258

Mtb Structural Proteome models

Model Number	1
Model name	Rv1611
Template	1VC4 APDB CREDO
Template coverage	6_253
Template Identity(%)	46.0
Model coverage(%)	91.9
Normalized DOPE score	-0.593

Structure Models from Chopin

Model Number	1
Profile	c.1.2.6 Click for model details
zscore	30.77
Residue begin	65
Residue end	272

Binding pockets

STRING

Cytoscape Web will replace the contents of this div with protein-protein interaction network.

Protein interacting with Rv1611	Gene name	Confidence Score
Rv1613	trpA	0.999
Rv2192c	trpD	0.999
Rv1609	trpE	0.999
Rv2192c	trpD	0.999
Rv1609	trpE	0.999
Rv1612	trpB	0.999
Rv0013	trpG	0.998
Rv1603	hisA	0.997
Rv1600	hisC1	0.983
Rv1605	hisF	0.976
Rv3838c	pheA	0.968
Rv3838c	pheA	0.968
Rv1606	hisI	0.962
Rv3336c	trpS	0.961
Rv1602	hisH	0.946
Rv2538c	aroB	0.94
Rv2540c	aroF	0.938
Rv1599	hisD	0.937
Rv1601	hisB	0.932
Rv1408	rpe	0.927
Rv3227	aroA	0.919
Rv3589	mutY	0.914
Rv3589	mutY	0.914
Rv2121c	hisG	0.914
Rv3754	tyrA	0.914
Rv2121c	hisG	0.914
Rv3772	hisC2	0.913
Rv2447c	folC	0.906
Rv2447c	folC	0.906
Rv3859c	gltB	0.903
Rv3859c	gltB	0.903
Rv3859c	gltB	0.903
Rv3859c	gltB	0.903
Rv2678c	hemE	0.902

Potential ligand/drug binding sites

No binding sites identified

Similarity to known drug target from sensitive sequence analysis

No drug targets

List of small molecules tested from TIBLE

Data not available

Off-target activity - ligand based from TIBLE

Data not available

Small molecules involved in protein-protein complex from TIMBAL .Proteins similar to Mtb based on sequence analysis.

Data not available

STITCH interactions

Chemical Name	Confidence score	Molecular Weight
indole-3-glycerol phosphatePubChem	0.997	287.206
IGPSPubChem	0.993	287.206
anthranilic acidPubChem	0.963	137.136
indolePubChem	0.938	117.148
N-(5'-phosphoribosyl)anthranilatePubChem	0.929	349.23
N-(5'-phosphoribosyl)-anthranilatePubChem	0.924	346.207
D-glyceraldehyde-3-phosphatePubChem	0.9	170.058
protiumPubChem	0.9	2.01576
1-(o-carboxyphenylamino)-1'-deoxyribulose-5'-PPubChem	0.9	349.23
H(+)PubChem	0.9	2.01588
C01302PubChem	0.9	349.23
phosphoribosylpyrophosphatePubChem	0.9	390.07
deuteriumPubChem	0.9	2.01588
hydroxyl radicalsPubChem	0.9	17.0073
glyceraldehyde-3-phosphatePubChem	0.9	170.058
carbon dioxidePubChem	0.9	44.0095
pyrophosphatePubChem	0.9	177.975
phosphatePubChem	0.827	96.9872
sulfatePubChem	0.797	96.0626
hydron sulfatePubChem	0.797	196.157
rCdRPPubChem	0.75	351.246
1lbfPubChem	0.75	351.246
hydron diphosphatePubChem	0.75	391.981
hygromycin BPubChem	0.708	527.52