SInCRe - Rv0408

Tuberculist information

Gene name	pta
Protein function	Probable phosphate acetyltransferase Pta (phosphotransacetylase)
Functional category(tuberculist)	intermediary metabolism and respiration
Gene location(kb)	491.786
Molecular mass(da)	72930.5
External sites	TB Database TubercuList WebTB

Protein sequence

Number of amino acids : 690

	  		  	1    LADSSAIYLAAPESQTGKSTIALGLLHRLTAMVAKVGVFRPITRLSAERDYILELLLAHT   60
			  	61   SAGLPYERCVGVTYQQLHADRDDAIAEIVDSYHAMADECDAVVVVGSDYTDVTSPTELSV  120
			  	121  NGRIAVNLGAPVLLTVRAKDRTPDQVASVVEVCLAELDTQRAHTAAVVANRCELSAIPAV  180
			  	181  TDALRRFTPPSYVVPEEPLLSAPTVAELTQAVNGAVVSGDVALREREVMGVLAAGMTADH  240
			  	241  VLERLTDGMAVITPGDRSDVVLAVASAHAAEGFPSLSCIVLNGGFQLHPAIAALVSGLRL  300
			  	301  RLPVIATALGTYDTASAAASARGLVTATSQRKIDTALELMDRHVDVAGLLAQLTIPIPTV  360
			  	361  TTPQMFTYRLLQQARSDLMRIVLPEGDDDRILKSAGRLLQRGIVDLTILGDEAKVRLRAA  420
			  	421  ELGVDLDGATVIEPCASELHDQFADQYAQLRKAKGITVEHAREIMNDATYFGTMLVHNCH  480
			  	481  ADGMVSGAAHTTAHTVRPALEIIKTVPGISTVSSIFLMCLPDRVLAYGDCAIIPNPTVEQ  540
			  	541  LADIAICSARTAAQFGIEPRVAMLSYSTGDSGKGADVDKVRAATELVRAREPQLPVEGPI  600
			  	601  QYDAAVEPSVAATKLRDSPVAGRATVLIFPDLNTGNNTYKAVQRSAGAIAIGPVLQGLRK  660
			  	661  PVNDLSRGALVDDIVNTVAITAIQAQGVHE

Known structures in the PDB

No Known structures

Number of amino acids : 690

Domains assigned based on sequence.

Mtb Structural proteome models

CHOPIN models

Profile-based domain assignment

Structural/Functional domain family	Pfam acc.no./SCOP ID	Domain Region
AAA_26	PF13500	5-204
DRTGG	PF07085	207-321
PTA_PTB	PF01515	365-682

Mtb Structural Proteome models

Model Number	1
Model name	Rv0408
Template	1R5J APDB CREDO
Template coverage	19_326
Template Identity(%)	48.5
Model coverage(%)	44.3
Normalized DOPE score	-1.101

Model Number	2
Model name	Rv0408.1
Template	1BYI APDB CREDO
Template coverage	1_224
Template Identity(%)	17.3
Model coverage(%)	30.8
Normalized DOPE score	-0.491

Structure Models from Chopin

Model Number	1
Profile	c.77.1.5 Click for model details
zscore	71.96
Residue begin	365
Residue end	682

Model Number	2
Profile	c.98.2.2 - 3.40.1390.20 Click for model details
zscore	15.96
Residue begin	207
Residue end	321

Model Number	3
Profile	c.37.1.10 - 3.40.50.300 Click for model details
zscore	11.27
Residue begin	5
Residue end	204

Binding pockets

STRING

Cytoscape Web will replace the contents of this div with protein-protein interaction network.

Protein interacting with Rv0408	Gene name	Confidence Score
Rv0409	ackA	0.999
Rv3667	acs	0.992
Rv3667	acs	0.992
Rv3535c	hsaG	0.986
Rv3535c	hsaG	0.986
Rv2495c	bkdC	0.985
Rv2495c	bkdC	0.985
Rv2495c	bkdC	0.985
Rv1617	pykA	0.968
Rv1617	pykA	0.968
Rv3028c	fixB	0.956
Rv3028c	fixB	0.956
Rv1074c	fadA3	0.95
Rv1074c	fadA3	0.95
Rv1323	fadA4	0.949
Rv1323	fadA4	0.949
Rv3556c	fadA6	0.945
Rv3556c	fadA6	0.945
Rv0904c	accD3	0.944
Rv1837c	glcB	0.944
Rv0859	fadA	0.942
Rv0859	fadA	0.942
Rv3029c	fixA	0.941
Rv1437	pgk	0.935
Rv3546	fadA5	0.934
Rv3546	fadA5	0.934
Rv0243	fadA2	0.931
Rv0243	fadA2	0.931
Rv1018c	glmU	0.926
Rv1018c	glmU	0.926
Rv0914c	Rv0914c	0.921
Rv0914c	Rv0914c	0.921
Rv2455c	Rv2455c	0.919
Rv2455c	Rv2455c	0.919
Rv0973c	accA2	0.918
Rv0973c	accA2	0.918
Rv0973c	accA2	0.918
Rv0973c	accA2	0.918
Rv0975c	fadE13	0.914
Rv0975c	fadE13	0.914
Rv0975c	fadE13	0.914
Rv1436	gap	0.913
Rv1436	gap	0.913
Rv0753c	mmsA	0.912
Rv3280	accD5	0.91
Rv3710	leuA	0.909
Rv3710	leuA	0.909
Rv0154c	fadE2	0.907
Rv0154c	fadE2	0.907
Rv3140	fadE23	0.907
Rv0154c	fadE2	0.907
Rv3140	fadE23	0.907
Rv2922A	acyP	0.902

Potential ligand/drug binding sites

Protein Model	Pocket Number	Drug Binding Site	PMIN Score	Pvalue PMIN	PMAX Score	Pvalue PMAX
Rv0408.1	1	1c6z_ROC_B_505 PDB CREDO	0.667	0.108	0.667	0.001
Rv0408.1	1	3el4_ROC_A_100 PDB CREDO	0.720	0.066	0.654	0.001
Rv0408.1	1	3ufn_ROC_A_401 PDB CREDO	0.722	0.065	0.652	0.001
Rv0408.1	3	2nni_MTK_A_501 PDB CREDO	0.663	0.112	0.644	0.001
Rv0408.1	1	3sm2_478_A_126 PDB CREDO	0.658	0.116	0.642	0.001
Rv0408.1	3	1sa1_POD_B_700 PDB CREDO	0.677	0.100	0.639	0.001
Rv0408.1	3	3ut5_LOC_D_502 PDB CREDO	0.757	0.044	0.632	0.001
Rv0408.1	1	2q64_1UN_B_1001 PDB CREDO	0.630	0.145	0.630	0.001
Rv0408.1	3	3ut5_LOC_B_502 PDB CREDO	0.709	0.074	0.629	0.001
Rv0408.1	1	2qak_1UN_A_1001 PDB CREDO	0.629	0.146	0.629	0.001
Rv0408.1	1	2q63_1UN_A_1001 PDB CREDO	0.627	0.148	0.627	0.001
Rv0408.1	3	3frq_ERY_A_195 PDB CREDO	0.646	0.129	0.627	0.001
Rv0408.1	1	2pyn_1UN_A_1001 PDB CREDO	0.627	0.149	0.627	0.001
Rv0408.1	1	2pym_1UN_A_1001 PDB CREDO	0.625	0.150	0.625	0.001
Rv0408.1	1	2qxs_RAL_B_600 PDB CREDO	0.749	0.048	0.625	0.001
Rv0408.1	1	2qxs_RAL_A_600 PDB CREDO	0.749	0.049	0.624	0.001
Rv0408.1	3	1sa1_POD_D_701 PDB CREDO	0.681	0.096	0.624	0.001
Rv0408.1	3	1hwk_117_B_1 PDB CREDO	0.619	0.157	0.619	0.001
Rv0408.1	1	3cs9_NIL_C_600 PDB CREDO	0.698	0.083	0.614	0.002
Rv0408.1	1	3cs9_NIL_D_600 PDB CREDO	0.692	0.087	0.609	0.002
Rv0408.1	1	3el5_1UN_B_201 PDB CREDO	0.624	0.152	0.608	0.002
Rv0408.1	1	2nnk_ROC_A_401 PDB CREDO	0.654	0.120	0.608	0.002
Rv0408.1	1	2f80_017_B_301 PDB CREDO	0.608	0.169	0.608	0.002
Rv0408.1	1	1n49_RIT_B_301 PDB CREDO	0.746	0.050	0.605	0.002
Rv0408.1	1	1t46_STI_A_3 PDB CREDO	0.687	0.091	0.605	0.002
Rv0408.1	1	3gp0_NIL_A_1 PDB CREDO	0.668	0.108	0.603	0.002
Rv0408.1	1	1rl8_RIT_A_9001 PDB CREDO	0.616	0.160	0.601	0.002
Rv0408.1	1	3ndt_ROC_D_100 PDB CREDO	0.646	0.128	0.600	0.002
Rv0408.1	1	1xkk_FMM_A_91 PDB CREDO	0.646	0.129	0.598	0.002
Rv0408.1	1	3prs_RIT_A_1001 PDB CREDO	0.613	0.164	0.598	0.002
Rv0408.1	3	3e22_LOC_D_700 PDB CREDO	0.715	0.070	0.597	0.002
Rv0408.1	1	1c6y_MK1_B_524 PDB CREDO	0.697	0.083	0.597	0.002
Rv0408.1	1	3el9_DR7_A_100 PDB CREDO	0.695	0.084	0.596	0.002
Rv0408.1	3	1uwj_BAX_A_1723 PDB CREDO	0.613	0.164	0.596	0.002
Rv0408.1	3	3e22_LOC_B_700 PDB CREDO	0.712	0.072	0.594	0.002
Rv0408.1	1	3d1y_ROC_A_201 PDB CREDO	0.609	0.168	0.594	0.002
Rv0408.1	1	1hxb_ROC_A_100 PDB CREDO	0.593	0.188	0.593	0.002
Rv0408.1	1	3s56_ROC_A_201 PDB CREDO	0.692	0.087	0.593	0.002
Rv0408.1	1	1t7i_017_A_200 PDB CREDO	0.649	0.125	0.589	0.003
Rv0408.1	1	3ogq_AB1_A_200 PDB CREDO	0.619	0.157	0.589	0.003
Rv0408.1	1	3ekq_ROC_A_100 PDB CREDO	0.706	0.076	0.589	0.003
Rv0408.1	1	3k4v_ROC_D_201 PDB CREDO	0.663	0.112	0.587	0.003
Rv0408.1	1	3bvb_017_B_401 PDB CREDO	0.616	0.161	0.586	0.003
Rv0408.1	1	3ggu_017_B_201 PDB CREDO	0.630	0.145	0.584	0.003
Rv0408.1	1	1ya4_CTX_A_1 PDB CREDO	0.612	0.165	0.583	0.003
Rv0408.1	1	1k6c_MK1_B_902 PDB CREDO	0.642	0.133	0.582	0.003
Rv0408.1	3	1xkk_FMM_A_91 PDB CREDO	0.724	0.064	0.582	0.003
Rv0408.1	1	3pww_ROC_A_1001 PDB CREDO	0.659	0.116	0.580	0.003
Rv0408.1	1	2fxd_DR7_A_102 PDB CREDO	0.676	0.100	0.579	0.003
Rv0408.1	3	1z2b_VLB_C_800 PDB CREDO	0.632	0.143	0.579	0.003
Rv0408.1	1	1n49_RIT_D_401 PDB CREDO	0.776	0.034	0.579	0.003
Rv0408.1	3	3frq_ERY_B_195 PDB CREDO	0.692	0.087	0.578	0.003
Rv0408.1	1	3el0_1UN_A_201 PDB CREDO	0.731	0.059	0.577	0.003
Rv0408.1	3	1hwk_117_A_2 PDB CREDO	0.603	0.176	0.569	0.004
Rv0408.1	3	1hwk_117_C_4 PDB CREDO	0.602	0.177	0.568	0.004
Rv0408.1	1	3pwr_ROC_A_401 PDB CREDO	0.596	0.184	0.567	0.004
Rv0408.1	3	1uwj_BAX_B_1723 PDB CREDO	0.601	0.178	0.567	0.004
Rv0408.1	1	3cs9_NIL_B_600 PDB CREDO	0.677	0.099	0.565	0.004
Rv0408.1	1	3ndu_ROC_D_100 PDB CREDO	0.667	0.109	0.564	0.004
Rv0408.1	3	1hwl_FBI_B_1 PDB CREDO	0.616	0.160	0.564	0.004
Rv0408.1	3	3d91_REM_A_350 PDB CREDO	0.598	0.182	0.564	0.004
Rv0408.1	3	3d91_REM_B_350 PDB CREDO	0.598	0.182	0.564	0.004
Rv0408.1	1	1opj_STI_A_3 PDB CREDO	0.695	0.085	0.564	0.004
Rv0408.1	1	3cs9_NIL_A_600 PDB CREDO	0.695	0.085	0.564	0.004
Rv0408.1	3	1hwl_FBI_D_3 PDB CREDO	0.614	0.162	0.562	0.004
Rv0408.1	1	2nnp_ROC_A_401 PDB CREDO	0.619	0.156	0.562	0.004
Rv0408.1	3	1uwh_BAX_B_1723 PDB CREDO	0.629	0.146	0.559	0.004
Rv0408.1	1	1opj_STI_B_4 PDB CREDO	0.688	0.090	0.558	0.004
Rv0408.1	1	3lzv_017_A_200 PDB CREDO	0.707	0.075	0.558	0.004
Rv0408.1	3	1uwh_BAX_A_1723 PDB CREDO	0.627	0.148	0.557	0.004
Rv0408.1	1	1hxw_RIT_B_301 PDB CREDO	0.601	0.178	0.557	0.004
Rv0408.1	1	2aqu_DR7_B_300 PDB CREDO	0.571	0.216	0.556	0.004
Rv0408.1	3	3tkd_CYZ_B_267 PDB CREDO	0.625	0.150	0.555	0.005
Rv0408.1	1	2nmy_ROC_A_401 PDB CREDO	0.670	0.105	0.555	0.005
Rv0408.1	1	3oxx_DR7_A_100 PDB CREDO	0.568	0.219	0.554	0.005
Rv0408.1	1	3ekx_1UN_B_201 PDB CREDO	0.582	0.201	0.553	0.005
Rv0408.1	3	3spk_TPV_B_100 PDB CREDO	0.569	0.217	0.553	0.005
Rv0408.1	3	3bjw_SVR_E_503 PDB CREDO	0.636	0.139	0.553	0.005
Rv0408.1	1	2r5p_MK1_B_902 PDB CREDO	0.596	0.183	0.553	0.005
Rv0408.1	1	3so9_017_A_100 PDB CREDO	0.834	0.014	0.552	0.005
Rv0408.1	1	2r5p_MK1_D_902 PDB CREDO	0.596	0.184	0.552	0.005
Rv0408.1	1	3spk_TPV_B_100 PDB CREDO	0.762	0.041	0.552	0.005
Rv0408.1	3	1t46_STI_A_3 PDB CREDO	0.651	0.124	0.551	0.005
Rv0408.1	3	1hwl_FBI_A_2 PDB CREDO	0.602	0.177	0.551	0.005
Rv0408.1	3	1hwl_FBI_C_4 PDB CREDO	0.602	0.177	0.551	0.005
Rv0408.1	1	3rgf_BAX_A_465 PDB CREDO	0.718	0.068	0.551	0.005
Rv0408.1	1	2fxe_DR7_A_102 PDB CREDO	0.592	0.189	0.549	0.005
Rv0408.1	1	3em4_DR7_V_100 PDB CREDO	0.592	0.189	0.548	0.005
Rv0408.1	1	3oxx_DR7_C_100 PDB CREDO	0.562	0.228	0.548	0.005
Rv0408.1	1	3ucb_017_A_201 PDB CREDO	0.589	0.193	0.547	0.005
Rv0408.1	1	3eky_DR7_A_100 PDB CREDO	0.589	0.192	0.546	0.005
Rv0408.1	3	1hwk_117_D_3 PDB CREDO	0.615	0.162	0.546	0.005
Rv0408.1	1	1hsh_MK1_A_401 PDB CREDO	0.637	0.137	0.546	0.005
Rv0408.1	3	1hwi_115_B_1 PDB CREDO	0.652	0.123	0.544	0.006
Rv0408.1	1	1sdv_MK1_B_902 PDB CREDO	0.618	0.158	0.544	0.006
Rv0408.1	1	2avv_MK1_E_902 PDB CREDO	0.598	0.181	0.543	0.006
Rv0408.1	1	2v0z_C41_C_1328 PDB CREDO	0.557	0.235	0.543	0.006
Rv0408.1	1	2aoi_FRD_C_305 PDB CREDO	0.542	0.255	0.542	0.006
Rv0408.1	3	3h52_486_B_1 PDB CREDO	0.592	0.189	0.542	0.006
Rv0408.1	1	2w8y_486_A_1000 PDB CREDO	0.771	0.037	0.542	0.006
Rv0408.1	3	1hwi_115_D_3 PDB CREDO	0.648	0.126	0.541	0.006
Rv0408.1	3	3sm2_478_A_126 PDB CREDO	0.705	0.077	0.539	0.006
Rv0408.1	1	1ohr_1UN_A_201 PDB CREDO	0.629	0.146	0.539	0.006
Rv0408.1	1	3h52_486_A_3 PDB CREDO	0.813	0.020	0.538	0.006
Rv0408.1	1	1hsh_MK1_C_402 PDB CREDO	0.627	0.148	0.537	0.006
Rv0408.1	3	2oax_SNL_E_5001 PDB CREDO	0.585	0.198	0.535	0.006
Rv0408.1	1	2avv_MK1_A_901 PDB CREDO	0.590	0.191	0.535	0.006
Rv0408.1	1	1sdt_MK1_B_902 PDB CREDO	0.562	0.227	0.535	0.006
Rv0408.1	1	1sh9_RIT_B_301 PDB CREDO	0.625	0.151	0.535	0.006
Rv0408.1	3	1lhv_NOG_A_301 PDB CREDO	0.661	0.114	0.534	0.006
Rv0408.1	1	3h52_486_B_1 PDB CREDO	0.782	0.032	0.534	0.007
Rv0408.1	3	3b0w_DGX_A_1 PDB CREDO	0.565	0.223	0.533	0.007
Rv0408.1	3	3h52_486_D_2 PDB CREDO	0.600	0.180	0.533	0.007
Rv0408.1	3	2oax_SNL_F_6001 PDB CREDO	0.581	0.203	0.532	0.007
Rv0408.1	3	3tkd_CYZ_A_266 PDB CREDO	0.636	0.139	0.531	0.007
Rv0408.1	1	2xkw_P1B_A_1478 PDB CREDO	0.558	0.233	0.530	0.007
Rv0408.1	1	3k5v_STI_A_2 PDB CREDO	0.672	0.104	0.530	0.007
Rv0408.1	3	2oax_SNL_D_4001 PDB CREDO	0.578	0.206	0.530	0.007
Rv0408.1	1	3kk6_CEL_A_701 PDB CREDO	0.571	0.216	0.529	0.007
Rv0408.1	1	3ogp_017_B_200 PDB CREDO	0.708	0.075	0.527	0.007
Rv0408.1	1	1tco_FK5_C_509 PDB CREDO	0.554	0.238	0.527	0.007
Rv0408.1	1	3tkg_ROC_C_901 PDB CREDO	0.608	0.169	0.527	0.007
Rv0408.1	3	2oax_SNL_A_1001 PDB CREDO	0.575	0.210	0.527	0.007
Rv0408.1	3	2v0z_C41_O_1327 PDB CREDO	0.638	0.137	0.526	0.007
Rv0408.1	1	3oez_STI_A_601 PDB CREDO	0.706	0.076	0.526	0.007
Rv0408.1	1	3oxc_ROC_A_401 PDB CREDO	0.694	0.085	0.526	0.007
Rv0408.1	1	3h52_486_D_2 PDB CREDO	0.793	0.028	0.525	0.007
Rv0408.1	3	3b0w_DGX_B_1 PDB CREDO	0.554	0.238	0.523	0.008
Rv0408.1	1	2v0z_C41_O_1327 PDB CREDO	0.580	0.204	0.523	0.008
Rv0408.1	1	2r5q_1UN_D_900 PDB CREDO	0.721	0.066	0.522	0.008
Rv0408.1	3	3kk6_CEL_A_701 PDB CREDO	0.649	0.126	0.522	0.008
Rv0408.1	1	2r5q_1UN_B_900 PDB CREDO	0.720	0.066	0.522	0.008
Rv0408.1	1	2o4k_DR7_A_301 PDB CREDO	0.599	0.180	0.519	0.008
Rv0408.1	1	3cyx_ROC_A_201 PDB CREDO	0.613	0.164	0.519	0.008
Rv0408.1	1	2aof_FRD_C_305 PDB CREDO	0.585	0.198	0.518	0.008
Rv0408.1	3	2y6o_1N1_A_1892 PDB CREDO	0.640	0.134	0.518	0.008
Rv0408.1	1	1err_RAL_B_600 PDB CREDO	0.806	0.023	0.517	0.008
Rv0408.1	1	3pyy_STI_A_3 PDB CREDO	0.694	0.086	0.517	0.008
Rv0408.1	3	3tne_RIT_A_401 PDB CREDO	0.619	0.157	0.517	0.008
Rv0408.1	1	1err_RAL_A_600 PDB CREDO	0.805	0.023	0.517	0.008
Rv0408.1	1	3ogp_017_A_200 PDB CREDO	0.757	0.044	0.517	0.008
Rv0408.1	1	2pl0_STI_A_200 PDB CREDO	0.757	0.044	0.516	0.009
Rv0408.1	3	3jwq_VIA_D_901 PDB CREDO	0.729	0.060	0.516	0.009
Rv0408.1	1	2jfa_RAL_B_600 PDB CREDO	0.804	0.023	0.516	0.009
Rv0408.1	1	1uwj_BAX_A_1723 PDB CREDO	0.672	0.104	0.515	0.009
Rv0408.1	1	3pyy_STI_B_4 PDB CREDO	0.691	0.088	0.515	0.009
Rv0408.1	1	3em4_DR7_A_100 PDB CREDO	0.601	0.178	0.515	0.009
Rv0408.1	1	2hyy_STI_C_600 PDB CREDO	0.690	0.089	0.514	0.009
Rv0408.1	1	1sgu_MK1_B_2632 PDB CREDO	0.689	0.090	0.513	0.009
Rv0408.1	1	3mss_STI_B_1 PDB CREDO	0.689	0.090	0.513	0.009
Rv0408.1	1	2hyy_STI_D_600 PDB CREDO	0.688	0.090	0.513	0.009
Rv0408.1	1	3k5v_STI_B_2 PDB CREDO	0.688	0.090	0.513	0.009
Rv0408.1	1	3ms9_STI_B_1 PDB CREDO	0.688	0.090	0.513	0.009
Rv0408.1	1	1iep_STI_A_201 PDB CREDO	0.688	0.090	0.513	0.009
Rv0408.1	3	1n49_RIT_D_401 PDB CREDO	0.513	0.299	0.513	0.009
Rv0408.1	1	1iep_STI_B_202 PDB CREDO	0.687	0.091	0.512	0.009
Rv0408.1	1	2hyy_STI_A_600 PDB CREDO	0.687	0.091	0.512	0.009
Rv0408.1	1	3mss_STI_D_1 PDB CREDO	0.687	0.091	0.512	0.009
Rv0408.1	1	4asd_BAX_A_1500 PDB CREDO	0.729	0.060	0.512	0.009
Rv0408.1	1	3mss_STI_A_1 PDB CREDO	0.686	0.092	0.511	0.009
Rv0408.1	1	3gvu_STI_A_1001 PDB CREDO	0.686	0.092	0.511	0.009
Rv0408.1	1	3ms9_STI_A_1 PDB CREDO	0.686	0.092	0.511	0.009
Rv0408.1	3	3bjw_SVR_B_501 PDB CREDO	0.635	0.139	0.511	0.009
Rv0408.1	1	3mss_STI_C_1 PDB CREDO	0.685	0.092	0.511	0.009
Rv0408.1	3	2oax_SNL_B_2001 PDB CREDO	0.611	0.166	0.510	0.009
Rv0408.1	3	1hwi_115_A_2 PDB CREDO	0.673	0.103	0.510	0.009
Rv0408.1	3	2ab2_SNL_A_502 PDB CREDO	0.611	0.166	0.510	0.009
Rv0408.1	3	2ab2_SNL_B_503 PDB CREDO	0.610	0.167	0.509	0.009
Rv0408.1	1	2aoj_FRD_C_305 PDB CREDO	0.702	0.079	0.509	0.010
Rv0408.1	3	3bjw_SVR_F_502 PDB CREDO	0.631	0.143	0.508	0.010
Rv0408.1	3	4asd_BAX_A_1500 PDB CREDO	0.538	0.261	0.507	0.010
Rv0408.1	3	1uob_PNN_A_1311 PDB CREDO	0.553	0.240	0.506	0.010
Rv0408.1	1	3k4v_ROC_B_201 PDB CREDO	0.712	0.072	0.506	0.010
Rv0408.1	1	2jfa_RAL_A_600 PDB CREDO	0.812	0.021	0.505	0.010
Rv0408.1	1	3ekw_DR7_B_100 PDB CREDO	0.531	0.271	0.505	0.010
Rv0408.1	3	3vhu_SNL_A_1001 PDB CREDO	0.605	0.173	0.505	0.010
Rv0408.1	3	3bjw_SVR_H_504 PDB CREDO	0.627	0.148	0.504	0.010
Rv0408.1	1	2avo_MK1_B_902 PDB CREDO	0.503	0.313	0.503	0.010
Rv0408.1	3	2oax_SNL_C_3001 PDB CREDO	0.603	0.176	0.503	0.010
Rv0408.1	3	3kk6_CEL_B_1701 PDB CREDO	0.562	0.227	0.503	0.010
Rv0408.1	3	3mnp_DEX_A_784 PDB CREDO	0.584	0.199	0.503	0.010
Rv0408.1	1	3nuj_478_B_401 PDB CREDO	0.502	0.315	0.502	0.011
Rv0408.1	1	3nu4_478_B_401 PDB CREDO	0.571	0.216	0.502	0.011
Rv0408.1	1	3tkg_ROC_B_801 PDB CREDO	0.692	0.087	0.502	0.011
Rv0408.1	1	3em3_478_B_200 PDB CREDO	0.527	0.276	0.502	0.011
Rv0408.1	3	3spk_TPV_A_100 PDB CREDO	0.684	0.094	0.501	0.011
Rv0408.1	1	3nuo_478_B_478 PDB CREDO	0.555	0.237	0.501	0.011
Rv0408.1	1	1sdu_MK1_B_902 PDB CREDO	0.526	0.278	0.501	0.011
Rv0408.1	1	4dqf_017_B_101 PDB CREDO	0.526	0.278	0.500	0.011

Similarity to known drug target from sensitive sequence analysis

No drug targets

List of small molecules tested from TIBLE

Data not available

Off-target activity - ligand based from TIBLE

Data not available

Small molecules involved in protein-protein complex from TIMBAL .Proteins similar to Mtb based on sequence analysis.

Data not available

STITCH interactions

Chemical Name	Confidence score	Molecular Weight
acetyl phosphatePubChem	0.991	140.032
acetyl-CoAPubChem	0.987	809.571
acetatePubChem	0.982	59.044
coenzyme APubChem	0.976	767.534
butyryl-CoAPubChem	0.971	837.624
propionyl-CoAPubChem	0.968	823.597
phosphatePubChem	0.963	96.9872
butyratePubChem	0.962	88.1051
formatePubChem	0.961	45.0174
Co-APubChem	0.958	767.534
NAD+PubChem	0.943	663.425
adenosine triphosphatePubChem	0.934	507.181
propionyl phosphatePubChem	0.93	154.058
crotonyl-CoAPubChem	0.927	835.608
carbon dioxidePubChem	0.921	44.0095
pyrophosphatePubChem	0.903	177.975
H(+)PubChem	0.902	2.01588
deuteriumPubChem	0.902	2.01588
adenosine monophosphatePubChem	0.9	347.221
protiumPubChem	0.9	2.01576
pyruvic acidPubChem	0.9	88.0621
butyryl phosphatePubChem	0.9	168.085
acetyl coenzyme-APubChem	0.9	809.571
reduced nicotinamide adenine dinucleotidePubChem	0.9	665.441
dihydronicotinamide formycin dinucleotidePubChem	0.9	665.441
adenosine diphosphatePubChem	0.9	427.201
[(2S,5S)-5-(6-aminopurin-9-yl)-4-hydroxy-2-[[[[(3R)-3-hydroxy-2,2-dimethyl-4-oxo-4-[[3-oxo-3-[2-(1-oPubChem	0.9	833.592
glycerolPubChem	0.804	92.0938
thiamine pyrophosphatePubChem	0.742	425.314
selenomethioninePubChem	0.74	196.106
SeMetPubChem	0.74	196.106
acetate asPubChem	0.736	404.497
lactatePubChem	0.725	90.0779
CoASHPubChem	0.724	1049.79
acetaldehydePubChem	0.714	44.0526
sulfatePubChem	0.708	96.0626