SInCRe - Rv1837c

Tuberculist information

Gene name	glcB
Protein function	Malate synthase G GlcB
Functional category(tuberculist)	intermediary metabolism and respiration
Gene location(kb)	2084.76
Molecular mass(da)	80403
External sites	TB Database TubercuList WebTB

Protein sequence

Number of amino acids : 741

	  		  	1    MTDRVSVGNLRIARVLYDFVNNEALPGTDIDPDSFWAGVDKVVADLTPQNQALLNARDEL   60
			  	61   QAQIDKWHRRRVIEPIDMDAYRQFLTEIGYLLPEPDDFTITTSGVDAEITTTAGPQLVVP  120
			  	121  VLNARFALNAANARWGSLYDALYGTDVIPETDGAEKGPTYNKVRGDKVIAYARKFLDDSV  180
			  	181  PLSSGSFGDATGFTVQDGQLVVALPDKSTGLANPGQFAGYTGAAESPTSVLLINHGLHIE  240
			  	241  ILIDPESQVGTTDRAGVKDVILESAITTIMDFEDSVAAVDAADKVLGYRNWLGLNKGDLA  300
			  	301  AAVDKDGTAFLRVLNRDRNYTAPGGGQFTLPGRSLMFVRNVGHLMTNDAIVDTDGSEVFE  360
			  	361  GIMDALFTGLIAIHGLKASDVNGPLINSRTGSIYIVKPKMHGPAEVAFTCELFSRVEDVL  420
			  	421  GLPQNTMKIGIMDEERRTTVNLKACIKAAADRVVFINTGFLDRTGDEIHTSMEAGPMVRK  480
			  	481  GTMKSQPWILAYEDHNVDAGLAAGFSGRAQVGKGMWTMTELMADMVETKIAQPRAGASTA  540
			  	541  WVPSPTAATLHALHYHQVDVAAVQQGLAGKRRATIEQLLTIPLAKELAWAPDEIREEVDN  600
			  	601  NCQSILGYVVRWVDQGVGCSKVPDIHDVALMEDRATLRISSQLLANWLRHGVITSADVRA  660
			  	661  SLERMAPLVDRQNAGDVAYRPMAPNFDDSIAFLAAQELILSGAQQPNGYTEPILHRRRRE  720
			  	721  FKARAAEKPAPSDRAGDDAAR

Known structures in the PDB

	PDB ID	1N8I
	Total residue count	741
	Number of chains	1
	Method	X-RAY
	Resolution	2.1

	PDB ID	1N8W
	Total residue count	1482
	Number of chains	2
	Method	X-RAY
	Resolution	2.7

	PDB ID	2GQ3
	Total residue count	1458
	Number of chains	2
	Method	X-RAY
	Resolution	2.3

	PDB ID	3S9I
	Total residue count	741
	Number of chains	1
	Method	X-RAY
	Resolution	1.9

	PDB ID	3S9Z
	Total residue count	741
	Number of chains	1
	Method	X-RAY
	Resolution	1.79

	PDB ID	3SAD
	Total residue count	741
	Number of chains	1
	Method	X-RAY
	Resolution	1.82

	PDB ID	3SAZ
	Total residue count	741
	Number of chains	1
	Method	X-RAY
	Resolution	2.04

	PDB ID	3SB0
	Total residue count	741
	Number of chains	1
	Method	X-RAY
	Resolution	2.2

Number of amino acids : 741

Domains assigned based on sequence.

Mtb Structural proteome models

CHOPIN models

Profile-based domain assignment

Structural/Functional domain family	Pfam acc.no./SCOP ID	Domain Region
Malate_synthase	PF01274	17-699

Mtb Structural Proteome models

Model Number	1
Model name	Rv1837c_1n8i_A
Template	1N8I APDB CREDO
Template coverage	2_727
Template Identity(%)	100.0
Model coverage(%)	97.8
Normalized DOPE score	-1.896

Model Number	2
Model name	Rv1837c
Template	1N8I APDB CREDO
Template coverage	2_727
Template Identity(%)	99.9
Model coverage(%)	97.8
Normalized DOPE score	-1.467

Structure Models from Chopin

Model Number	1
Profile	c.1.13.1 Click for model details
zscore	64.69
Residue begin	2
Residue end	727

Binding pockets

STRING

Cytoscape Web will replace the contents of this div with protein-protein interaction network.

Protein interacting with Rv1837c	Gene name	Confidence Score
Rv0467	icl1	0.997
Rv1257c	Rv1257c	0.973
Rv1257c	Rv1257c	0.973
Rv0896	gltA2	0.958
Rv3667	acs	0.954
Rv3667	acs	0.954
Rv1916	aceAb	0.95
Rv0408	pta	0.944
Rv0408	pta	0.944
Rv1240	mdh	0.944
Rv0408	pta	0.944
Rv1240	mdh	0.944
Rv1131	prpC	0.937
Rv2332	mez	0.931
Rv2332	mez	0.931
Rv1915	aceAa	0.924
Rv0904c	accD3	0.92
Rv1836c	Rv1836c	0.919
Rv1836c	Rv1836c	0.919
Rv0889c	citA	0.91
Rv2852c	mqo	0.91
Rv3710	leuA	0.909
Rv3710	leuA	0.909
Rv2967c	pca	0.907
Rv2967c	pca	0.907
Rv2967c	pca	0.907
Rv2967c	pca	0.907
Rv2967c	pca	0.907
Rv2967c	pca	0.907
Rv0243	fadA2	0.903
Rv0243	fadA2	0.903
Rv2495c	bkdC	0.901
Rv2495c	bkdC	0.901
Rv2495c	bkdC	0.901

Potential ligand/drug binding sites

Protein Model	Pocket Number	Drug Binding Site	PMIN Score	Pvalue PMIN	PMAX Score	Pvalue PMAX
Rv1837c_1n8i_A	3	2xpv_MIY_A_1209 PDB CREDO	0.712	0.072	0.712	0.000
Rv1837c_1n8i_A	3	1ya3_STR_B_2001 PDB CREDO	0.662	0.113	0.639	0.001
Rv1837c_1n8i_A	3	3rif_IVM_B_403 PDB CREDO	0.651	0.123	0.628	0.001
Rv1837c_1n8i_A	3	3rif_IVM_A_402 PDB CREDO	0.651	0.124	0.628	0.001
Rv1837c_1n8i_A	3	3rif_IVM_D_402 PDB CREDO	0.651	0.124	0.628	0.001
Rv1837c_1n8i_A	3	3ri5_IVM_C_350 PDB CREDO	0.650	0.124	0.627	0.001
Rv1837c_1n8i_A	3	3ria_IVM_C_349 PDB CREDO	0.646	0.128	0.623	0.001
Rv1837c_1n8i_A	3	1ya3_STR_A_1001 PDB CREDO	0.645	0.130	0.623	0.001
Rv1837c_1n8i_A	3	3rif_IVM_A_403 PDB CREDO	0.644	0.131	0.621	0.001
Rv1837c_1n8i_A	3	2aa5_STR_A_301 PDB CREDO	0.711	0.073	0.620	0.001
Rv1837c_1n8i_A	3	2aa5_STR_B_302 PDB CREDO	0.704	0.078	0.614	0.002
Rv1837c_1n8i_A	3	1ya3_STR_C_3001 PDB CREDO	0.659	0.116	0.613	0.002
Rv1837c_1n8i_A	3	1p93_DEX_B_2999 PDB CREDO	0.656	0.119	0.612	0.002
Rv1837c_1n8i_A	3	1p93_DEX_A_1999 PDB CREDO	0.654	0.121	0.610	0.002
Rv1837c_1n8i_A	3	3jwq_VIA_D_901 PDB CREDO	0.653	0.122	0.609	0.002
Rv1837c_1n8i_A	3	3rif_IVM_E_402 PDB CREDO	0.705	0.077	0.608	0.002
Rv1837c_1n8i_A	4	1fmo_ADN_E_351 PDB CREDO	0.684	0.093	0.608	0.002
Rv1837c_1n8i_A	3	3rhw_IVM_B_349 PDB CREDO	0.699	0.082	0.603	0.002
Rv1837c_1n8i_A	3	3jwq_VIA_B_901 PDB CREDO	0.625	0.151	0.603	0.002
Rv1837c_1n8i_A	3	3rhw_IVM_D_349 PDB CREDO	0.697	0.083	0.602	0.002
Rv1837c_1n8i_A	3	3ria_IVM_A_348 PDB CREDO	0.697	0.083	0.602	0.002
Rv1837c_1n8i_A	3	3rhw_IVM_B_348 PDB CREDO	0.697	0.083	0.602	0.002
Rv1837c_1n8i_A	3	3rhw_IVM_D_348 PDB CREDO	0.697	0.083	0.602	0.002
Rv1837c_1n8i_A	3	3ria_IVM_C_350 PDB CREDO	0.697	0.083	0.602	0.002
Rv1837c_1n8i_A	3	2xpw_OTC_A_222 PDB CREDO	0.723	0.064	0.601	0.002
Rv1837c_1n8i_A	3	3ri5_IVM_D_349 PDB CREDO	0.696	0.084	0.601	0.002
Rv1837c_1n8i_A	3	2h42_VIA_A_901 PDB CREDO	0.644	0.130	0.601	0.002
Rv1837c_1n8i_A	3	3ri5_IVM_B_349 PDB CREDO	0.695	0.085	0.600	0.002
Rv1837c_1n8i_A	3	3ria_IVM_E_348 PDB CREDO	0.695	0.085	0.600	0.002
Rv1837c_1n8i_A	3	1ict_T44_D_129 PDB CREDO	0.747	0.050	0.596	0.002
Rv1837c_1n8i_A	3	3rhw_IVM_A_348 PDB CREDO	0.691	0.088	0.596	0.002
Rv1837c_1n8i_A	3	2vke_TAC_A_222 PDB CREDO	0.717	0.068	0.596	0.002
Rv1837c_1n8i_A	3	3ri5_IVM_A_349 PDB CREDO	0.689	0.089	0.595	0.002
Rv1837c_1n8i_A	3	3ria_IVM_E_349 PDB CREDO	0.689	0.089	0.595	0.002
Rv1837c_1n8i_A	3	2aa6_STR_B_402 PDB CREDO	0.679	0.098	0.592	0.002
Rv1837c_1n8i_A	3	3e22_LOC_D_700 PDB CREDO	0.748	0.049	0.592	0.002
Rv1837c_1n8i_A	3	2aa6_STR_A_401 PDB CREDO	0.678	0.099	0.591	0.002
Rv1837c_1n8i_A	3	2aax_PDN_A_502 PDB CREDO	0.678	0.099	0.591	0.002
Rv1837c_1n8i_A	3	3h52_486_C_4 PDB CREDO	0.612	0.165	0.591	0.002
Rv1837c_1n8i_A	3	3e22_LOC_B_700 PDB CREDO	0.746	0.050	0.590	0.003
Rv1837c_1n8i_A	3	3vhu_SNL_A_1001 PDB CREDO	0.743	0.052	0.588	0.003
Rv1837c_1n8i_A	3	2aax_PDN_B_503 PDB CREDO	0.674	0.102	0.588	0.003
Rv1837c_1n8i_A	3	2ab2_SNL_A_502 PDB CREDO	0.742	0.052	0.587	0.003
Rv1837c_1n8i_A	3	2ab2_SNL_B_503 PDB CREDO	0.741	0.053	0.586	0.003
Rv1837c_1n8i_A	3	3ut5_LOC_D_502 PDB CREDO	0.738	0.055	0.584	0.003
Rv1837c_1n8i_A	3	2oax_SNL_C_3001 PDB CREDO	0.736	0.056	0.582	0.003
Rv1837c_1n8i_A	3	2oax_SNL_B_2001 PDB CREDO	0.735	0.057	0.582	0.003
Rv1837c_1n8i_A	3	3mne_DEX_A_784 PDB CREDO	0.687	0.091	0.580	0.003
Rv1837c_1n8i_A	3	2q1v_PDN_A_248 PDB CREDO	0.598	0.181	0.578	0.003
Rv1837c_1n8i_A	3	2h42_VIA_C_903 PDB CREDO	0.599	0.181	0.578	0.003
Rv1837c_1n8i_A	3	2trt_TAC_A_222 PDB CREDO	0.753	0.046	0.578	0.003
Rv1837c_1n8i_A	3	2o7o_DXT_A_222 PDB CREDO	0.752	0.047	0.577	0.003
Rv1837c_1n8i_A	3	1jg2_ADN_A_500 PDB CREDO	0.595	0.185	0.574	0.003
Rv1837c_1n8i_A	3	3frq_ERY_B_195 PDB CREDO	0.725	0.063	0.574	0.003
Rv1837c_1n8i_A	3	1a28_STR_A_1 PDB CREDO	0.573	0.212	0.573	0.003
Rv1837c_1n8i_A	3	3ut5_LOC_B_502 PDB CREDO	0.770	0.037	0.573	0.003
Rv1837c_1n8i_A	3	1m2z_DEX_A_301 PDB CREDO	0.679	0.098	0.573	0.003
Rv1837c_1n8i_A	3	3gn8_DEX_A_247 PDB CREDO	0.678	0.099	0.572	0.003
Rv1837c_1n8i_A	3	2h42_VIA_B_902 PDB CREDO	0.593	0.188	0.572	0.003
Rv1837c_1n8i_A	3	1m2z_DEX_D_401 PDB CREDO	0.677	0.099	0.572	0.003
Rv1837c_1n8i_A	3	1fm6_BRL_D_503 PDB CREDO	0.571	0.215	0.571	0.004
Rv1837c_1n8i_A	3	3bbt_FMM_D_91 PDB CREDO	0.612	0.165	0.571	0.004
Rv1837c_1n8i_A	3	3gn8_DEX_B_247 PDB CREDO	0.676	0.100	0.571	0.004
Rv1837c_1n8i_A	3	1p93_DEX_D_4999 PDB CREDO	0.675	0.101	0.570	0.004
Rv1837c_1n8i_A	3	1p93_DEX_C_3999 PDB CREDO	0.674	0.102	0.569	0.004
Rv1837c_1n8i_A	3	3ri5_IVM_E_349 PDB CREDO	0.711	0.072	0.568	0.004
Rv1837c_1n8i_A	4	1kij_NOV_B_444 PDB CREDO	0.565	0.224	0.565	0.004
Rv1837c_1n8i_A	4	3k54_1N1_A_1 PDB CREDO	0.608	0.169	0.564	0.004
Rv1837c_1n8i_A	4	3kw2_ADN_A_300 PDB CREDO	0.585	0.198	0.563	0.004
Rv1837c_1n8i_A	3	2prg_BRL_A_1 PDB CREDO	0.563	0.227	0.563	0.004
Rv1837c_1n8i_A	3	1jg3_ADN_A_500 PDB CREDO	0.601	0.177	0.560	0.004
Rv1837c_1n8i_A	3	3mnp_DEX_A_784 PDB CREDO	0.729	0.060	0.559	0.004
Rv1837c_1n8i_A	3	3f4x_KLT_A_300 PDB CREDO	0.645	0.129	0.557	0.004
Rv1837c_1n8i_A	3	3q1e_T44_C_128 PDB CREDO	0.645	0.129	0.557	0.004
Rv1837c_1n8i_A	3	3mno_DEX_A_784 PDB CREDO	0.724	0.063	0.556	0.005
Rv1837c_1n8i_A	3	1nhz_486_A_800 PDB CREDO	0.615	0.161	0.555	0.005
Rv1837c_1n8i_A	4	2fum_MIX_C_2539 PDB CREDO	0.595	0.185	0.551	0.005
Rv1837c_1n8i_A	3	2oax_SNL_D_4001 PDB CREDO	0.762	0.041	0.550	0.005
Rv1837c_1n8i_A	3	1lhv_NOG_A_301 PDB CREDO	0.671	0.105	0.548	0.005
Rv1837c_1n8i_A	4	3kw2_ADN_B_300 PDB CREDO	0.591	0.190	0.546	0.005
Rv1837c_1n8i_A	3	2prg_BRL_B_2 PDB CREDO	0.546	0.249	0.546	0.005
Rv1837c_1n8i_A	3	3h52_486_D_2 PDB CREDO	0.733	0.058	0.545	0.005
Rv1837c_1n8i_A	3	2oax_SNL_E_5001 PDB CREDO	0.754	0.046	0.544	0.006
Rv1837c_1n8i_A	3	2oax_SNL_A_1001 PDB CREDO	0.753	0.046	0.544	0.006
Rv1837c_1n8i_A	4	3fuu_ADN_A_0 PDB CREDO	0.564	0.225	0.543	0.006
Rv1837c_1n8i_A	3	2oax_SNL_F_6001 PDB CREDO	0.752	0.047	0.543	0.006
Rv1837c_1n8i_A	3	1zgy_BRL_A_503 PDB CREDO	0.601	0.178	0.542	0.006
Rv1837c_1n8i_A	3	3h0a_9RA_A_500 PDB CREDO	0.578	0.206	0.539	0.006
Rv1837c_1n8i_A	3	1sa1_POD_D_701 PDB CREDO	0.744	0.051	0.537	0.006
Rv1837c_1n8i_A	3	1lhu_EST_A_301 PDB CREDO	0.536	0.263	0.536	0.006
Rv1837c_1n8i_A	3	1sqn_NDR_B_2001 PDB CREDO	0.535	0.265	0.535	0.006
Rv1837c_1n8i_A	3	3d90_NOG_A_1001 PDB CREDO	0.593	0.187	0.535	0.006
Rv1837c_1n8i_A	3	3d90_NOG_B_2001 PDB CREDO	0.593	0.188	0.534	0.006
Rv1837c_1n8i_A	3	1sqn_NDR_A_1001 PDB CREDO	0.534	0.266	0.534	0.006
Rv1837c_1n8i_A	3	1cil_ETS_A_263 PDB CREDO	0.573	0.213	0.534	0.006
Rv1837c_1n8i_A	3	3h52_486_B_1 PDB CREDO	0.740	0.053	0.534	0.006
Rv1837c_1n8i_A	3	2h79_T3_A_1 PDB CREDO	0.611	0.166	0.533	0.007
Rv1837c_1n8i_A	4	2fum_MIX_A_539 PDB CREDO	0.595	0.185	0.532	0.007
Rv1837c_1n8i_A	3	3aod_RFP_C_2002 PDB CREDO	0.572	0.215	0.532	0.007
Rv1837c_1n8i_A	3	3frq_ERY_A_195 PDB CREDO	0.781	0.033	0.531	0.007
Rv1837c_1n8i_A	3	1mx1_THA_C_3 PDB CREDO	0.531	0.272	0.531	0.007
Rv1837c_1n8i_A	4	4e3a_ADN_B_500 PDB CREDO	0.551	0.243	0.530	0.007
Rv1837c_1n8i_A	3	2xn5_FUN_A_1356 PDB CREDO	0.690	0.089	0.529	0.007
Rv1837c_1n8i_A	3	1sa1_POD_B_700 PDB CREDO	0.756	0.045	0.529	0.007
Rv1837c_1n8i_A	3	2h77_T3_A_1 PDB CREDO	0.586	0.196	0.528	0.007
Rv1837c_1n8i_A	4	1lhu_EST_A_301 PDB CREDO	0.612	0.165	0.528	0.007
Rv1837c_1n8i_A	3	1a28_STR_B_2 PDB CREDO	0.646	0.128	0.528	0.007
Rv1837c_1n8i_A	3	3qt0_486_A_4 PDB CREDO	0.565	0.223	0.527	0.007
Rv1837c_1n8i_A	4	2gqg_1N1_A_501 PDB CREDO	0.586	0.196	0.525	0.007
Rv1837c_1n8i_A	4	3g0e_B49_A_9000 PDB CREDO	0.590	0.191	0.525	0.007
Rv1837c_1n8i_A	3	3ln1_CEL_D_682 PDB CREDO	0.561	0.228	0.524	0.008
Rv1837c_1n8i_A	4	3qlg_1N1_A_601 PDB CREDO	0.544	0.253	0.523	0.008
Rv1837c_1n8i_A	3	1oq5_CEL_A_701 PDB CREDO	0.542	0.255	0.523	0.008
Rv1837c_1n8i_A	3	3k2h_LYA_B_514 PDB CREDO	0.523	0.283	0.523	0.008
Rv1837c_1n8i_A	4	3g5d_1N1_A_1 PDB CREDO	0.543	0.254	0.522	0.008
Rv1837c_1n8i_A	3	3spk_TPV_A_100 PDB CREDO	0.578	0.206	0.521	0.008
Rv1837c_1n8i_A	4	3qlg_1N1_B_601 PDB CREDO	0.541	0.256	0.521	0.008
Rv1837c_1n8i_A	3	2xkw_P1B_B_1475 PDB CREDO	0.537	0.262	0.518	0.008
Rv1837c_1n8i_A	3	1jip_KTN_A_801 PDB CREDO	0.702	0.079	0.518	0.008
Rv1837c_1n8i_A	4	3g5d_1N1_B_1 PDB CREDO	0.537	0.263	0.517	0.008
Rv1837c_1n8i_A	3	3oct_1N1_A_663 PDB CREDO	0.533	0.269	0.514	0.009
Rv1837c_1n8i_A	3	3tkd_CYZ_B_267 PDB CREDO	0.690	0.089	0.513	0.009
Rv1837c_1n8i_A	3	1ict_T44_C_128 PDB CREDO	0.696	0.084	0.513	0.009
Rv1837c_1n8i_A	3	3tkd_CYZ_A_266 PDB CREDO	0.647	0.127	0.512	0.009
Rv1837c_1n8i_A	4	2fum_MIX_D_3539 PDB CREDO	0.634	0.141	0.510	0.009
Rv1837c_1n8i_A	3	3sxr_1N1_A_1 PDB CREDO	0.638	0.136	0.510	0.009
Rv1837c_1n8i_A	3	3gws_T3_X_500 PDB CREDO	0.603	0.175	0.509	0.009
Rv1837c_1n8i_A	3	1jg3_ADN_B_550 PDB CREDO	0.612	0.164	0.509	0.010
Rv1837c_1n8i_A	3	3h52_486_A_3 PDB CREDO	0.684	0.094	0.509	0.010
Rv1837c_1n8i_A	3	3o1c_ADN_A_127 PDB CREDO	0.545	0.250	0.508	0.010
Rv1837c_1n8i_A	4	4e3a_ADN_A_500 PDB CREDO	0.594	0.186	0.507	0.010
Rv1837c_1n8i_A	3	3bbt_FMM_B_91 PDB CREDO	0.586	0.197	0.506	0.010
Rv1837c_1n8i_A	4	3sxr_1N1_A_1 PDB CREDO	0.546	0.250	0.505	0.010
Rv1837c_1n8i_A	3	1jin_KTN_A_801 PDB CREDO	0.632	0.143	0.505	0.010
Rv1837c_1n8i_A	3	1hwi_115_A_2 PDB CREDO	0.578	0.206	0.504	0.010
Rv1837c_1n8i_A	4	3tbg_RTZ_A_1 PDB CREDO	0.614	0.162	0.503	0.010
Rv1837c_1n8i_A	4	4eb4_D16_B_402 PDB CREDO	0.503	0.314	0.503	0.010
Rv1837c_1n8i_A	4	3sxr_1N1_B_2 PDB CREDO	0.565	0.224	0.502	0.011
Rv1837c_1n8i_A	3	1s9p_DES_A_459 PDB CREDO	0.502	0.315	0.502	0.011
Rv1837c_1n8i_A	4	1d4f_ADN_D_604 PDB CREDO	0.521	0.286	0.502	0.011
Rv1837c_1n8i_A	3	3uvv_T3_A_501 PDB CREDO	0.613	0.163	0.501	0.011
Rv1837c_1n8i_A	3	1ie4_T44_B_328 PDB CREDO	0.603	0.175	0.501	0.011
Rv1837c_1n8i_A	3	2ito_IRE_A_2020 PDB CREDO	0.581	0.203	0.501	0.011
Rv1837c_1n8i_A	4	1d4f_ADN_B_602 PDB CREDO	0.520	0.288	0.500	0.011
Rv1837c_1n8i_A	3	1fm6_BRL_X_504 PDB CREDO	0.612	0.165	0.500	0.011

Similarity to known drug target from sensitive sequence analysis

No drug targets

List of small molecules tested from TIBLE

Data not available

Off-target activity - ligand based from TIBLE

Data not available

Small molecules involved in protein-protein complex from TIMBAL .Proteins similar to Mtb based on sequence analysis.

Data not available

STITCH interactions

Chemical Name	Confidence score	Molecular Weight
glyoxylatePubChem	0.999	74.0355
malatePubChem	0.997	134.087
coenzyme APubChem	0.994	767.534
Co-APubChem	0.989	767.534
D-malatePubChem	0.989	134.087
sulfatePubChem	0.977	96.0626
magnesiumPubChem	0.974	24.305
acetyl-CoAPubChem	0.973	809.571
hydron sulfatePubChem	0.969	196.157
succinatePubChem	0.945	118.088
reduced nicotinamide adenine dinucleotidePubChem	0.918	665.441
NAD+PubChem	0.904	663.425
isocitratePubChem	0.9	192.124
dihydronicotinamide formycin dinucleotidePubChem	0.9	665.441
HEPESPubChem	0.9	238.305
oxaloacetatePubChem	0.9	132.072
protiumPubChem	0.9	2.01576
deuteriumPubChem	0.9	2.01588
H(+)PubChem	0.9	2.01588
hydroxyl radicalsPubChem	0.9	17.0073
D-isocitratePubChem	0.9	192.124
acetyl coenzyme-APubChem	0.9	809.571
DB01992PubChem	0.8	767.534
selenomethioninePubChem	0.762	196.106
polyglycolic acidPubChem	0.709	76.0514
mannitolPubChem	0.705	182.172
SeMetPubChem	0.705	196.106
sorbitolPubChem	0.705	182.172