SInCRe - Rv2215

Tuberculist information

Gene name	dlaT
Protein function	DlaT, dihydrolipoamide acyltransferase, E2 component of pyruvate dehydrogenase
Functional category(tuberculist)	intermediary metabolism and respiration
Gene location(kb)	2481.97
Molecular mass(da)	57087.7
External sites	TB Database TubercuList WebTB

Protein sequence

Number of amino acids : 553

	  		  	1    MAFSVQMPALGESVTEGTVTRWLKQEGDTVELDEPLVEVSTDKVDTEIPSPAAGVLTKII   60
			  	61   AQEDDTVEVGGELAVIGDAKDAGEAAAPAPEKVPAAQPESKPAPEPPPVQPTSGAPAGGD  120
			  	121  AKPVLMPELGESVTEGTVIRWLKKIGDSVQVDEPLVEVSTDKVDTEIPSPVAGVLVSISA  180
			  	181  DEDATVPVGGELARIGVAADIGAAPAPKPAPKPVPEPAPTPKAEPAPSPPAAQPAGAAEG  240
			  	241  APYVTPLVRKLASENNIDLAGVTGTGVGGRIRKQDVLAAAEQKKRAKAPAPAAQAAAAPA  300
			  	301  PKAPPAPAPALAHLRGTTQKASRIRQITANKTRESLQATAQLTQTHEVDMTKIVGLRARA  360
			  	361  KAAFAEREGVNLTFLPFFAKAVIDALKIHPNINASYNEDTKEITYYDAEHLGFAVDTEQG  420
			  	421  LLSPVIHDAGDLSLAGLARAIADIAARARSGNLKPDELSGGTFTITNIGSQGALFDTPIL  480
			  	481  VPPQAAMLGTGAIVKRPRVVVDASGNESIGVRSVCYLPLTYDHRLIDGADAGRFLTTIKH  540
			  	541  RLEEGAFEADLGL

Known structures in the PDB

No Known structures

Number of amino acids : 553

Domains assigned based on sequence.

Mtb Structural proteome models

CHOPIN models

Profile-based domain assignment

Structural/Functional domain family	Pfam acc.no./SCOP ID	Domain Region
Biotin_lipoyl	PF00364	3-76
Biotin_lipoyl	PF00364	122-195
E3_binding	PF02817	240-278
2-oxoacid_dh	PF00198	314-548

Mtb Structural Proteome models

Model Number	1
Model name	Rv2215.2
Template	1DCZ APDB CREDO
Template coverage	63_123
Template Identity(%)	37.7
Model coverage(%)	10.8
Normalized DOPE score	-0.886

Model Number	2
Model name	Rv2215.4
Template	1W85 IPDB CREDO
Template coverage	128_167
Template Identity(%)	40.0
Model coverage(%)	7.0
Normalized DOPE score	-0.857

Model Number	3
Model name	Rv2215.1
Template	1Y8O BPDB CREDO
Template coverage	134_226
Template Identity(%)	32.2
Model coverage(%)	15.5
Normalized DOPE score	-0.823

Model Number	4
Model name	Rv2215.3
Template	1Y8O BPDB CREDO
Template coverage	135_216
Template Identity(%)	38.8
Model coverage(%)	14.3
Normalized DOPE score	-0.798

Model Number	5
Model name	Rv2215
Template	1SCZ APDB CREDO
Template coverage	174_397
Template Identity(%)	41.1
Model coverage(%)	41.5
Normalized DOPE score	-0.692

Structure Models from Chopin

Model Number	1
Profile	c.43.1.1 - 3.30.559.10 Click for model details
zscore	28.66
Residue begin	301
Residue end	552

Model Number	2
Profile	a.9.1.1 - 4.10.320.10 Click for model details
zscore	13.69
Residue begin	235
Residue end	289

Model Number	3
Profile	b.84.1.1 - 2.40.50.100 Click for model details
zscore	12.35
Residue begin	113
Residue end	217

Binding pockets

STRING

Cytoscape Web will replace the contents of this div with protein-protein interaction network.

Protein interacting with Rv2215	Gene name	Confidence Score
Rv2496c	bkdB	0.999
Rv0462	lpdC	0.999
Rv0462	lpdC	0.999
Rv0951	sucC	0.999
Rv0462	lpdC	0.999
Rv0951	sucC	0.999
Rv2496c	bkdB	0.999
Rv2497c	bkdA	0.998
Rv2241	aceE	0.998
Rv0952	sucD	0.998
Rv0952	sucD	0.998
Rv1248c	Rv1248c	0.996
Rv1248c	Rv1248c	0.996
Rv1248c	Rv1248c	0.996
Rv3303c	lpdA	0.987
Rv3303c	lpdA	0.987
Rv3303c	lpdA	0.987
Rv0896	gltA2	0.986
Rv2429	ahpD	0.984
Rv2428	ahpC	0.982
Rv2217	lipB	0.964
Rv2218	lipA	0.964
Rv0794c	Rv0794c	0.962
Rv0794c	Rv0794c	0.962
Rv0794c	Rv0794c	0.962
Rv2713	sthA	0.957
Rv2713	sthA	0.957
Rv2713	sthA	0.957
Rv2495c	bkdC	0.953
Rv2495c	bkdC	0.953
Rv2495c	bkdC	0.953
Rv1131	prpC	0.926
Rv1098c	fum	0.923
Rv1098c	fum	0.923
Rv2216	Rv2216	0.92
Rv2216	Rv2216	0.92
Rv2455c	Rv2455c	0.914
Rv2455c	Rv2455c	0.914
Rv0889c	citA	0.911
Rv1617	pykA	0.91
Rv1617	pykA	0.91
Rv1310	atpD	0.903
Rv1310	atpD	0.903
Rv1310	atpD	0.903
Rv2454c	Rv2454c	0.903

Potential ligand/drug binding sites

Protein Model	Pocket Number	Drug Binding Site	PMIN Score	Pvalue PMIN	PMAX Score	Pvalue PMAX
Rv2215.1	1	3ads_IMN_B_3 PDB CREDO	0.715	0.070	0.657	0.001
Rv2215.1	1	1rv7_AB1_B_1001 PDB CREDO	0.649	0.126	0.649	0.001
Rv2215.1	1	2itz_IRE_A_2021 PDB CREDO	0.675	0.101	0.648	0.001
Rv2215.1	1	2ity_IRE_A_2020 PDB CREDO	0.702	0.079	0.648	0.001
Rv2215.2	1	2ity_IRE_A_2020 PDB CREDO	0.669	0.106	0.643	0.001
Rv2215.2	1	2itz_IRE_A_2021 PDB CREDO	0.642	0.132	0.642	0.001
Rv2215.1	1	3adx_IMN_B_3 PDB CREDO	0.665	0.110	0.638	0.001
Rv2215.2	4	3fl9_TOP_B_200 PDB CREDO	0.638	0.136	0.638	0.001
Rv2215.3	1	1xbb_STI_A_1 PDB CREDO	0.743	0.052	0.637	0.001
Rv2215.2	4	2w9s_TOP_C_1160 PDB CREDO	0.636	0.139	0.636	0.001
Rv2215.1	1	3ri5_IVM_A_349 PDB CREDO	0.744	0.051	0.635	0.001
Rv2215.2	4	1xbb_STI_A_1 PDB CREDO	0.702	0.079	0.634	0.001
Rv2215.2	4	3fl9_TOP_G_200 PDB CREDO	0.633	0.142	0.633	0.001
Rv2215.1	1	3rhw_IVM_A_348 PDB CREDO	0.741	0.053	0.633	0.001
Rv2215.2	4	2w9s_TOP_A_1160 PDB CREDO	0.632	0.143	0.632	0.001
Rv2215.2	1	1rv7_AB1_B_1001 PDB CREDO	0.657	0.117	0.631	0.001
Rv2215.1	1	2ito_IRE_A_2020 PDB CREDO	0.739	0.054	0.631	0.001
Rv2215.1	1	3ria_IVM_E_349 PDB CREDO	0.738	0.055	0.630	0.001
Rv2215.2	4	3fl9_TOP_A_200 PDB CREDO	0.628	0.148	0.628	0.001
Rv2215.1	1	3ri5_IVM_E_349 PDB CREDO	0.678	0.099	0.625	0.001
Rv2215.2	1	1jg3_ADN_B_550 PDB CREDO	0.673	0.103	0.621	0.001
Rv2215.3	4	3ug2_IRE_A_1 PDB CREDO	0.617	0.159	0.617	0.002
Rv2215.1	1	3ri5_IVM_B_349 PDB CREDO	0.722	0.065	0.616	0.002
Rv2215.3	4	3vkx_T3_A_301 PDB CREDO	0.646	0.128	0.616	0.002
Rv2215.1	1	3rhw_IVM_B_348 PDB CREDO	0.719	0.067	0.614	0.002
Rv2215.1	1	3ri5_IVM_D_349 PDB CREDO	0.719	0.067	0.614	0.002
Rv2215.1	1	3ria_IVM_A_348 PDB CREDO	0.719	0.067	0.614	0.002
Rv2215.2	4	3jw3_TOP_A_208 PDB CREDO	0.721	0.066	0.613	0.002
Rv2215.1	1	3rhw_IVM_D_349 PDB CREDO	0.718	0.068	0.612	0.002
Rv2215.1	1	3ria_IVM_E_348 PDB CREDO	0.718	0.068	0.612	0.002
Rv2215.1	1	3rif_IVM_E_402 PDB CREDO	0.718	0.068	0.612	0.002
Rv2215.1	1	3rhw_IVM_D_348 PDB CREDO	0.717	0.069	0.612	0.002
Rv2215.1	1	3rhw_IVM_B_349 PDB CREDO	0.715	0.070	0.610	0.002
Rv2215.1	1	3ria_IVM_C_350 PDB CREDO	0.713	0.071	0.609	0.002
Rv2215.2	1	2ito_IRE_A_2020 PDB CREDO	0.682	0.095	0.607	0.002
Rv2215.2	1	3ri5_IVM_E_349 PDB CREDO	0.631	0.144	0.606	0.002
Rv2215.2	4	3fl9_TOP_C_200 PDB CREDO	0.637	0.137	0.605	0.002
Rv2215.2	4	3vkx_T3_A_301 PDB CREDO	0.698	0.083	0.600	0.002
Rv2215.1	1	3rif_IVM_A_403 PDB CREDO	0.785	0.031	0.599	0.002
Rv2215.2	4	3jw5_TOP_A_208 PDB CREDO	0.599	0.180	0.599	0.002
Rv2215.2	4	3jw5_TOP_B_208 PDB CREDO	0.599	0.180	0.599	0.002
Rv2215.2	1	1jg3_ADN_A_500 PDB CREDO	0.726	0.062	0.599	0.002
Rv2215.3	1	1fb7_ROC_A_100 PDB CREDO	0.665	0.110	0.596	0.002
Rv2215.2	1	3ri5_IVM_A_349 PDB CREDO	0.670	0.105	0.596	0.002
Rv2215.2	1	3ria_IVM_E_349 PDB CREDO	0.669	0.106	0.595	0.002
Rv2215.2	4	3fl9_TOP_E_200 PDB CREDO	0.698	0.082	0.594	0.002
Rv2215.2	1	3rhw_IVM_A_348 PDB CREDO	0.668	0.108	0.594	0.002
Rv2215.3	4	2nnj_225_A_501 PDB CREDO	0.593	0.188	0.593	0.002
Rv2215.1	1	1jg3_ADN_B_550 PDB CREDO	0.665	0.110	0.590	0.003
Rv2215.2	4	3fl9_TOP_D_200 PDB CREDO	0.694	0.086	0.590	0.003
Rv2215.1	1	3ri5_IVM_C_350 PDB CREDO	0.772	0.036	0.590	0.003
Rv2215.1	1	3rif_IVM_A_402 PDB CREDO	0.771	0.037	0.589	0.003
Rv2215.1	1	3ria_IVM_C_349 PDB CREDO	0.769	0.038	0.587	0.003
Rv2215.1	1	3rif_IVM_D_402 PDB CREDO	0.769	0.038	0.587	0.003
Rv2215.2	1	3rif_IVM_E_402 PDB CREDO	0.657	0.118	0.584	0.003
Rv2215.3	4	3rem_SAL_A_301 PDB CREDO	0.614	0.163	0.584	0.003
Rv2215.2	1	3ri5_IVM_D_349 PDB CREDO	0.656	0.118	0.583	0.003
Rv2215.1	1	1jg3_ADN_A_500 PDB CREDO	0.736	0.056	0.583	0.003
Rv2215.3	4	3rem_SAL_B_301 PDB CREDO	0.613	0.164	0.583	0.003
Rv2215.2	1	3ri5_IVM_B_349 PDB CREDO	0.656	0.119	0.583	0.003
Rv2215.1	1	3bbt_FMM_B_91 PDB CREDO	0.682	0.095	0.582	0.003
Rv2215.2	1	3ria_IVM_E_348 PDB CREDO	0.655	0.120	0.582	0.003
Rv2215.1	1	3rif_IVM_B_403 PDB CREDO	0.762	0.041	0.582	0.003
Rv2215.2	4	2nnj_225_A_501 PDB CREDO	0.644	0.131	0.582	0.003
Rv2215.2	1	3rhw_IVM_B_348 PDB CREDO	0.654	0.121	0.581	0.003
Rv2215.2	1	3rhw_IVM_D_349 PDB CREDO	0.654	0.121	0.581	0.003
Rv2215.2	1	3ria_IVM_C_350 PDB CREDO	0.654	0.121	0.581	0.003
Rv2215.1	1	1ie4_T44_A_128 PDB CREDO	0.581	0.203	0.581	0.003
Rv2215.1	1	1m17_AQ4_A_999 PDB CREDO	0.581	0.203	0.581	0.003
Rv2215.2	1	3rhw_IVM_D_348 PDB CREDO	0.653	0.121	0.581	0.003
Rv2215.2	1	3ria_IVM_A_348 PDB CREDO	0.653	0.121	0.581	0.003
Rv2215.2	1	3rhw_IVM_B_349 PDB CREDO	0.651	0.124	0.578	0.003
Rv2215.3	1	3ug2_IRE_A_1 PDB CREDO	0.674	0.102	0.578	0.003
Rv2215.3	4	3n8w_FLP_A_701 PDB CREDO	0.577	0.208	0.577	0.003
Rv2215.2	4	3jw3_TOP_B_208 PDB CREDO	0.761	0.042	0.576	0.003
Rv2215.1	1	3sxr_1N1_A_1 PDB CREDO	0.622	0.153	0.574	0.003
Rv2215.1	1	3sxr_1N1_B_2 PDB CREDO	0.598	0.182	0.574	0.003
Rv2215.2	4	2w9s_TOP_B_1160 PDB CREDO	0.638	0.136	0.574	0.003
Rv2215.2	4	3fl9_TOP_F_200 PDB CREDO	0.675	0.102	0.574	0.003
Rv2215.2	1	1m17_AQ4_A_999 PDB CREDO	0.595	0.185	0.571	0.004
Rv2215.3	4	3rf4_FUN_B_202 PDB CREDO	0.596	0.184	0.567	0.004
Rv2215.2	1	1ie4_T44_A_128 PDB CREDO	0.590	0.191	0.567	0.004
Rv2215.2	1	1jg2_ADN_A_500 PDB CREDO	0.763	0.041	0.566	0.004
Rv2215.3	4	3rf4_FUN_C_203 PDB CREDO	0.594	0.187	0.565	0.004
Rv2215.3	4	3ret_SAL_A_201 PDB CREDO	0.694	0.086	0.563	0.004
Rv2215.3	4	3ret_SAL_B_201 PDB CREDO	0.694	0.086	0.563	0.004
Rv2215.2	1	2fum_MIX_C_2539 PDB CREDO	0.585	0.197	0.562	0.004
Rv2215.3	4	3hgx_SAL_B_104 PDB CREDO	0.692	0.087	0.562	0.004
Rv2215.3	4	3rf4_FUN_A_201 PDB CREDO	0.590	0.191	0.561	0.004
Rv2215.2	1	1ie4_T44_B_328 PDB CREDO	0.607	0.171	0.560	0.004
Rv2215.2	4	3gvu_STI_A_1002 PDB CREDO	0.623	0.152	0.560	0.004
Rv2215.1	1	2uxo_TAC_B_1211 PDB CREDO	0.583	0.200	0.560	0.004
Rv2215.3	4	1qhs_CLM_A_999 PDB CREDO	0.560	0.231	0.560	0.004
Rv2215.1	1	1sn5_T3_C_601 PDB CREDO	0.582	0.201	0.559	0.004
Rv2215.2	4	3ug2_IRE_A_1 PDB CREDO	0.618	0.158	0.559	0.004
Rv2215.2	1	3ads_IMN_B_3 PDB CREDO	0.633	0.142	0.558	0.004
Rv2215.2	1	3sxr_1N1_B_2 PDB CREDO	0.558	0.232	0.558	0.004
Rv2215.2	1	3adx_IMN_B_3 PDB CREDO	0.558	0.234	0.558	0.004
Rv2215.3	4	3mdv_CL6_B_506 PDB CREDO	0.557	0.234	0.557	0.004
Rv2215.3	4	3hgx_SAL_A_102 PDB CREDO	0.685	0.093	0.556	0.005
Rv2215.3	4	2bdm_TMI_A_502 PDB CREDO	0.555	0.237	0.555	0.005
Rv2215.3	1	2w9g_TOP_A_1159 PDB CREDO	0.586	0.197	0.555	0.005
Rv2215.2	4	2w9g_TOP_A_1159 PDB CREDO	0.617	0.159	0.555	0.005
Rv2215.2	1	3sxr_1N1_A_1 PDB CREDO	0.577	0.207	0.555	0.005
Rv2215.3	1	1qhy_CLM_A_999 PDB CREDO	0.646	0.129	0.554	0.005
Rv2215.3	1	3jw5_TOP_A_208 PDB CREDO	0.583	0.200	0.553	0.005
Rv2215.1	1	1jg2_ADN_A_500 PDB CREDO	0.777	0.034	0.553	0.005
Rv2215.2	1	3rif_IVM_A_403 PDB CREDO	0.695	0.085	0.553	0.005
Rv2215.2	4	1qhy_CLM_A_999 PDB CREDO	0.611	0.166	0.552	0.005
Rv2215.1	1	3r9c_ECL_A_451 PDB CREDO	0.876	0.006	0.552	0.005
Rv2215.3	4	3pgh_FLP_B_701 PDB CREDO	0.637	0.138	0.552	0.005
Rv2215.1	1	1mx1_THA_A_1 PDB CREDO	0.574	0.211	0.551	0.005
Rv2215.3	1	2nnj_225_A_501 PDB CREDO	0.642	0.133	0.550	0.005
Rv2215.2	1	3rif_IVM_A_402 PDB CREDO	0.691	0.088	0.549	0.005
Rv2215.3	1	3r9c_ECL_A_451 PDB CREDO	0.579	0.205	0.549	0.005
Rv2215.3	4	3b2r_VDN_B_1 PDB CREDO	0.661	0.114	0.547	0.005
Rv2215.2	1	3rif_IVM_D_402 PDB CREDO	0.688	0.090	0.547	0.005
Rv2215.1	1	1mx1_THA_D_4 PDB CREDO	0.593	0.188	0.547	0.005
Rv2215.2	1	3kw2_ADN_B_300 PDB CREDO	0.569	0.218	0.547	0.005
Rv2215.1	1	3oht_1N1_A_1000 PDB CREDO	0.665	0.110	0.546	0.005
Rv2215.2	1	3ri5_IVM_C_350 PDB CREDO	0.687	0.091	0.546	0.005
Rv2215.1	1	1mx1_THA_F_6 PDB CREDO	0.592	0.189	0.546	0.005
Rv2215.2	1	3ria_IVM_C_349 PDB CREDO	0.686	0.092	0.545	0.005
Rv2215.2	1	3rif_IVM_B_403 PDB CREDO	0.686	0.092	0.545	0.005
Rv2215.2	1	4e3a_ADN_A_500 PDB CREDO	0.568	0.219	0.545	0.005
Rv2215.3	1	3jw5_TOP_B_208 PDB CREDO	0.575	0.211	0.545	0.005
Rv2215.3	4	3hm1_J3Z_A_2 PDB CREDO	0.628	0.147	0.544	0.005
Rv2215.2	1	2w9s_TOP_D_1158 PDB CREDO	0.590	0.191	0.544	0.006
Rv2215.3	4	3b2r_VDN_A_1 PDB CREDO	0.655	0.120	0.542	0.006
Rv2215.1	1	1ie4_T44_B_328 PDB CREDO	0.611	0.167	0.541	0.006
Rv2215.2	4	1qhs_CLM_A_999 PDB CREDO	0.599	0.180	0.541	0.006
Rv2215.3	4	2bxf_DZP_A_2001 PDB CREDO	0.624	0.151	0.541	0.006
Rv2215.1	1	3lfa_1N1_A_361 PDB CREDO	0.563	0.226	0.540	0.006
Rv2215.3	1	3gvu_STI_A_1002 PDB CREDO	0.569	0.218	0.539	0.006
Rv2215.3	4	2jap_J01_A_1249 PDB CREDO	0.566	0.222	0.539	0.006
Rv2215.2	4	1dyr_TOP_A_407 PDB CREDO	0.567	0.221	0.538	0.006
Rv2215.3	1	3grv_ADN_A_300 PDB CREDO	0.690	0.089	0.537	0.006
Rv2215.3	4	2jap_J01_D_1249 PDB CREDO	0.563	0.226	0.537	0.006
Rv2215.3	1	3fl9_TOP_A_200 PDB CREDO	0.565	0.224	0.536	0.006
Rv2215.3	4	2bxf_DZP_B_2001 PDB CREDO	0.617	0.159	0.535	0.006
Rv2215.3	4	2uxp_CLM_B_1211 PDB CREDO	0.617	0.159	0.535	0.006
Rv2215.3	1	1uay_ADN_B_1002 PDB CREDO	0.632	0.143	0.535	0.006
Rv2215.2	4	3fre_TOP_X_300 PDB CREDO	0.706	0.076	0.534	0.006
Rv2215.3	4	1xbb_STI_A_1 PDB CREDO	0.534	0.267	0.534	0.006
Rv2215.3	1	3jw3_TOP_A_208 PDB CREDO	0.595	0.185	0.533	0.007
Rv2215.1	1	1ya4_CTX_C_3 PDB CREDO	0.578	0.206	0.533	0.007
Rv2215.2	4	1r9o_FLP_A_501 PDB CREDO	0.680	0.097	0.533	0.007
Rv2215.1	1	1ict_T44_C_128 PDB CREDO	0.532	0.269	0.532	0.007
Rv2215.3	1	3fl9_TOP_F_200 PDB CREDO	0.594	0.187	0.532	0.007
Rv2215.3	4	2jap_J01_B_1249 PDB CREDO	0.559	0.232	0.532	0.007
Rv2215.3	4	2jap_J01_C_1249 PDB CREDO	0.559	0.232	0.532	0.007
Rv2215.1	1	3bbt_FMM_D_91 PDB CREDO	0.774	0.036	0.532	0.007
Rv2215.1	1	1ya4_CTX_B_2 PDB CREDO	0.577	0.208	0.532	0.007
Rv2215.3	1	3fl9_TOP_B_200 PDB CREDO	0.560	0.230	0.532	0.007
Rv2215.3	4	1qhy_CLM_A_999 PDB CREDO	0.532	0.270	0.532	0.007
Rv2215.3	4	3mdt_VOR_B_506 PDB CREDO	0.620	0.156	0.532	0.007
Rv2215.3	4	1r9o_FLP_A_501 PDB CREDO	0.612	0.165	0.531	0.007
Rv2215.3	4	2uxp_CLM_A_1211 PDB CREDO	0.612	0.165	0.531	0.007
Rv2215.3	4	3r9c_ECL_A_451 PDB CREDO	0.587	0.195	0.530	0.007
Rv2215.3	4	3fl9_TOP_A_200 PDB CREDO	0.586	0.197	0.529	0.007
Rv2215.3	1	3fl9_TOP_C_200 PDB CREDO	0.529	0.274	0.529	0.007
Rv2215.3	1	2w9s_TOP_C_1160 PDB CREDO	0.558	0.233	0.529	0.007
Rv2215.1	1	1sn0_T44_C_601 PDB CREDO	0.628	0.147	0.529	0.007
Rv2215.2	4	3hm1_J3Z_A_2 PDB CREDO	0.675	0.101	0.529	0.007
Rv2215.3	1	2w9s_TOP_A_1160 PDB CREDO	0.556	0.235	0.528	0.007
Rv2215.2	4	3clb_TMQ_B_612 PDB CREDO	0.672	0.104	0.526	0.007
Rv2215.3	1	3fl9_TOP_G_200 PDB CREDO	0.555	0.237	0.526	0.007
Rv2215.3	4	1e7a_PFL_A_4001 PDB CREDO	0.613	0.164	0.526	0.007
Rv2215.2	4	3grv_ADN_A_300 PDB CREDO	0.640	0.135	0.525	0.007
Rv2215.1	1	3ug2_IRE_A_1 PDB CREDO	0.751	0.047	0.524	0.008
Rv2215.2	4	3hgx_SAL_B_104 PDB CREDO	0.583	0.200	0.524	0.008
Rv2215.2	4	3ret_SAL_B_201 PDB CREDO	0.583	0.200	0.524	0.008
Rv2215.3	1	1sn0_T44_B_602 PDB CREDO	0.552	0.241	0.524	0.008
Rv2215.3	4	1e7a_PFL_B_4001 PDB CREDO	0.610	0.167	0.523	0.008
Rv2215.3	1	1yi4_ADN_A_306 PDB CREDO	0.522	0.285	0.522	0.008
Rv2215.2	4	3clb_TMQ_C_613 PDB CREDO	0.636	0.139	0.522	0.008
Rv2215.3	4	2w9s_TOP_C_1160 PDB CREDO	0.576	0.209	0.521	0.008
Rv2215.2	4	3hbb_TMQ_A_611 PDB CREDO	0.634	0.140	0.520	0.008
Rv2215.3	1	3uq6_ADN_B_401 PDB CREDO	0.669	0.107	0.520	0.008
Rv2215.2	1	3oht_1N1_A_1000 PDB CREDO	0.607	0.170	0.520	0.008
Rv2215.3	4	3ads_IMN_B_3 PDB CREDO	0.685	0.092	0.520	0.008
Rv2215.1	1	3k54_1N1_A_1 PDB CREDO	0.656	0.118	0.520	0.008
Rv2215.2	4	3hgx_SAL_A_102 PDB CREDO	0.578	0.206	0.520	0.008
Rv2215.2	4	3ret_SAL_A_201 PDB CREDO	0.578	0.206	0.520	0.008
Rv2215.2	4	3tq8_TOP_A_2001 PDB CREDO	0.520	0.288	0.520	0.008
Rv2215.2	4	1qku_EST_B_600 PDB CREDO	0.663	0.112	0.519	0.008
Rv2215.3	4	2eva_ADN_A_498 PDB CREDO	0.518	0.290	0.518	0.008
Rv2215.3	1	3uq6_ADN_A_401 PDB CREDO	0.666	0.110	0.518	0.008
Rv2215.3	4	3ik6_HCZ_B_800 PDB CREDO	0.544	0.253	0.517	0.008
Rv2215.1	1	3oht_1N1_B_1000 PDB CREDO	0.702	0.080	0.517	0.008
Rv2215.2	4	1qku_EST_A_600 PDB CREDO	0.660	0.115	0.517	0.008
Rv2215.2	1	3k54_1N1_A_1 PDB CREDO	0.626	0.149	0.516	0.008
Rv2215.3	1	3jw3_TOP_B_208 PDB CREDO	0.647	0.127	0.516	0.009
Rv2215.1	1	1mx1_THA_B_2 PDB CREDO	0.516	0.293	0.516	0.009
Rv2215.2	4	1pcg_EST_B_2 PDB CREDO	0.659	0.116	0.516	0.009
Rv2215.2	4	1qku_EST_C_600 PDB CREDO	0.659	0.116	0.516	0.009
Rv2215.3	4	1eqg_IBP_B_1701 PDB CREDO	0.595	0.185	0.516	0.009
Rv2215.3	4	2w9s_TOP_A_1160 PDB CREDO	0.571	0.216	0.516	0.009
Rv2215.3	4	3mdt_VOR_A_506 PDB CREDO	0.602	0.177	0.516	0.009
Rv2215.1	1	2w9s_TOP_D_1158 PDB CREDO	0.537	0.262	0.515	0.009
Rv2215.1	1	3uq6_ADN_B_401 PDB CREDO	0.671	0.105	0.515	0.009
Rv2215.2	4	1ere_EST_B_600 PDB CREDO	0.657	0.117	0.515	0.009
Rv2215.2	4	3hbb_TMQ_B_612 PDB CREDO	0.570	0.217	0.515	0.009
Rv2215.3	4	3fl9_TOP_G_200 PDB CREDO	0.570	0.217	0.515	0.009
Rv2215.3	4	3jw5_TOP_A_208 PDB CREDO	0.570	0.217	0.515	0.009
Rv2215.2	4	3n8y_DIF_B_585 PDB CREDO	0.626	0.149	0.514	0.009
Rv2215.2	4	1ere_EST_E_600 PDB CREDO	0.656	0.119	0.514	0.009
Rv2215.1	1	3kw2_ADN_B_300 PDB CREDO	0.557	0.234	0.514	0.009
Rv2215.3	4	3fl9_TOP_B_200 PDB CREDO	0.568	0.219	0.513	0.009
Rv2215.3	4	1mx1_THA_A_1 PDB CREDO	0.706	0.076	0.513	0.009
Rv2215.2	4	1yi4_ADN_A_306 PDB CREDO	0.541	0.257	0.513	0.009
Rv2215.2	4	3qfx_CP6_B_702 PDB CREDO	0.571	0.216	0.513	0.009
Rv2215.3	4	1eqg_IBP_A_701 PDB CREDO	0.591	0.189	0.513	0.009
Rv2215.2	1	1fmo_ADN_E_351 PDB CREDO	0.513	0.299	0.513	0.009
Rv2215.2	4	1ere_EST_A_600 PDB CREDO	0.653	0.121	0.512	0.009
Rv2215.2	4	1g50_EST_B_1600 PDB CREDO	0.653	0.121	0.512	0.009
Rv2215.2	1	3qlg_1N1_B_601 PDB CREDO	0.553	0.239	0.511	0.009
Rv2215.1	1	1xbb_STI_A_1 PDB CREDO	0.733	0.058	0.511	0.009
Rv2215.1	1	3tmz_06X_A_503 PDB CREDO	0.556	0.236	0.511	0.009
Rv2215.2	1	3qlg_1N1_A_601 PDB CREDO	0.553	0.240	0.511	0.009
Rv2215.3	4	3n8y_DIF_B_585 PDB CREDO	0.562	0.227	0.511	0.009
Rv2215.3	4	3gvu_STI_A_1002 PDB CREDO	0.628	0.148	0.510	0.009
Rv2215.1	1	2nnj_225_A_501 PDB CREDO	0.730	0.059	0.509	0.009
Rv2215.1	1	3uq6_ADN_A_401 PDB CREDO	0.663	0.112	0.509	0.009
Rv2215.2	4	3qfx_CP6_A_602 PDB CREDO	0.566	0.222	0.509	0.010
Rv2215.3	1	1uay_ADN_A_1001 PDB CREDO	0.684	0.093	0.508	0.010
Rv2215.3	4	1xoz_CIA_A_501 PDB CREDO	0.587	0.195	0.508	0.010
Rv2215.2	4	3tbg_RTZ_B_1 PDB CREDO	0.619	0.156	0.508	0.010
Rv2215.2	1	3g5d_1N1_B_1 PDB CREDO	0.550	0.244	0.508	0.010
Rv2215.2	1	2uxo_TAC_B_1211 PDB CREDO	0.508	0.306	0.508	0.010
Rv2215.1	1	1r9o_FLP_A_501 PDB CREDO	0.631	0.144	0.508	0.010
Rv2215.2	4	1fb7_ROC_A_100 PDB CREDO	0.597	0.183	0.507	0.010
Rv2215.2	4	3r9c_ECL_A_451 PDB CREDO	0.507	0.307	0.507	0.010
Rv2215.2	4	1gwr_EST_A_600 PDB CREDO	0.648	0.127	0.507	0.010
Rv2215.3	4	1tbf_VIA_A_501 PDB CREDO	0.585	0.197	0.507	0.010
Rv2215.2	1	3bbt_FMM_B_91 PDB CREDO	0.571	0.216	0.507	0.010
Rv2215.1	1	3spk_TPV_A_100 PDB CREDO	0.762	0.041	0.506	0.010
Rv2215.3	4	3ilt_TRU_E_800 PDB CREDO	0.506	0.309	0.506	0.010
Rv2215.3	4	3jw5_TOP_B_208 PDB CREDO	0.560	0.230	0.506	0.010
Rv2215.3	4	3jwq_VIA_C_901 PDB CREDO	0.532	0.270	0.506	0.010
Rv2215.3	4	3clb_TMQ_C_613 PDB CREDO	0.557	0.234	0.506	0.010
Rv2215.2	4	1gwr_EST_B_600 PDB CREDO	0.645	0.129	0.505	0.010
Rv2215.3	4	3hbb_TMQ_A_611 PDB CREDO	0.556	0.236	0.505	0.010
Rv2215.3	4	3uq6_ADN_B_401 PDB CREDO	0.556	0.236	0.505	0.010
Rv2215.3	4	3ik6_HCZ_B_262 PDB CREDO	0.559	0.232	0.505	0.010
Rv2215.1	1	1mx1_THA_C_3 PDB CREDO	0.685	0.093	0.504	0.010
Rv2215.1	1	3qlg_1N1_A_601 PDB CREDO	0.568	0.219	0.504	0.010
Rv2215.3	1	3fre_TOP_X_300 PDB CREDO	0.631	0.144	0.504	0.010
Rv2215.1	1	2fum_MIX_C_2539 PDB CREDO	0.546	0.250	0.504	0.010
Rv2215.3	4	1ya4_CTX_C_3 PDB CREDO	0.783	0.032	0.504	0.010
Rv2215.1	1	1mrl_DOL_A_300 PDB CREDO	0.525	0.280	0.503	0.010
Rv2215.3	4	3mdv_CL6_A_506 PDB CREDO	0.580	0.203	0.503	0.010
Rv2215.3	4	3pgh_FLP_A_701 PDB CREDO	0.580	0.203	0.503	0.010
Rv2215.3	4	2bxe_1FL_A_2001 PDB CREDO	0.528	0.276	0.503	0.010
Rv2215.3	4	1ya4_CTX_B_2 PDB CREDO	0.782	0.032	0.503	0.010
Rv2215.3	4	1uay_ADN_A_1001 PDB CREDO	0.579	0.205	0.502	0.011
Rv2215.3	4	2bxe_1FL_B_2001 PDB CREDO	0.527	0.277	0.502	0.011
Rv2215.2	1	3g5d_1N1_A_1 PDB CREDO	0.543	0.254	0.502	0.011
Rv2215.2	4	3jwq_VIA_C_901 PDB CREDO	0.528	0.276	0.501	0.011
Rv2215.2	1	1sn5_T3_C_601 PDB CREDO	0.544	0.252	0.501	0.011
Rv2215.3	4	3adx_IMN_B_3 PDB CREDO	0.749	0.048	0.501	0.011
Rv2215.2	4	1mx1_THA_A_1 PDB CREDO	0.762	0.041	0.501	0.011
Rv2215.1	1	3g5d_1N1_B_1 PDB CREDO	0.565	0.224	0.501	0.011
Rv2215.2	1	3spk_TPV_A_100 PDB CREDO	0.723	0.064	0.501	0.011
Rv2215.2	1	3uq6_ADN_B_401 PDB CREDO	0.679	0.098	0.500	0.011

Similarity to known drug target from sensitive sequence analysis

No drug targets

List of small molecules tested from TIBLE

Data not available

Off-target activity - ligand based from TIBLE

Data not available

Small molecules involved in protein-protein complex from TIMBAL .Proteins similar to Mtb based on sequence analysis.

Data not available

STITCH interactions

Chemical Name	Confidence score	Molecular Weight
dihydrolipoamidePubChem	0.979	207.357
acetyl-CoAPubChem	0.955	809.571
coenzyme APubChem	0.948	767.534
NAD+PubChem	0.945	663.425
succinyl-CoAPubChem	0.944	867.607
Co-APubChem	0.935	767.534
LPMPubChem	0.926	207.357
pyruvic acidPubChem	0.92	88.0621
citratePubChem	0.91	192.124
carbon dioxidePubChem	0.907	44.0095
glutaryl coenzyme APubChem	0.9	881.633
reduced nicotinamide adenine dinucleotidePubChem	0.9	665.441
acetyl coenzyme-APubChem	0.9	809.571
oxaloacetatePubChem	0.9	132.072
dihydronicotinamide formycin dinucleotidePubChem	0.9	665.441
6-S-acetyldihydrolipoamidePubChem	0.9	249.393
glutaryl-CoAPubChem	0.9	881.633
deuteriumPubChem	0.9	2.01588
protiumPubChem	0.9	2.01576
hydroxyl radicalsPubChem	0.9	17.0073
H(+)PubChem	0.9	2.01588
lipoic acidPubChem	0.751	206.326