SInCRe - Rv1248c

Tuberculist information

Gene name	Rv1248c
Protein function	Multifunctional alpha-ketoglutarate metabolic enzyme
Functional category(tuberculist)	intermediary metabolism and respiration
Gene location(kb)	1389.36
Molecular mass(da)	135870
External sites	TB Database TubercuList WebTB

Protein sequence

Number of amino acids : 1231

	  		  	1    VANISSPFGQNEWLVEEMYRKFRDDPSSVDPSWHEFLVDYSPEPTSQPAAEPTRVTSPLV   60
			  	61   AERAAAAAPQAPPKPADTAAAGNGVVAALAAKTAVPPPAEGDEVAVLRGAAAAVVKNMSA  120
			  	121  SLEVPTATSVRAVPAKLLIDNRIVINNQLKRTRGGKISFTHLLGYALVQAVKKFPNMNRH  180
			  	181  YTEVDGKPTAVTPAHTNLGLAIDLQGKDGKRSLVVAGIKRCETMRFAQFVTAYEDIVRRA  240
			  	241  RDGKLTTEDFAGVTISLTNPGTIGTVHSVPRLMPGQGAIIGVGAMEYPAEFQGASEERIA  300
			  	301  ELGIGKLITLTSTYDHRIIQGAESGDFLRTIHELLLSDGFWDEVFRELSIPYLPVRWSTD  360
			  	361  NPDSIVDKNARVMNLIAAYRNRGHLMADTDPLRLDKARFRSHPDLEVLTHGLTLWDLDRV  420
			  	421  FKVDGFAGAQYKKLRDVLGLLRDAYCRHIGVEYAHILDPEQKEWLEQRVETKHVKPTVAQ  480
			  	481  QKYILSKLNAAEAFETFLQTKYVGQKRFSLEGAESVIPMMDAAIDQCAEHGLDEVVIGMP  540
			  	541  HRGRLNVLANIVGKPYSQIFTEFEGNLNPSQAHGSGDVKYHLGATGLYLQMFGDNDIQVS  600
			  	601  LTANPSHLEAVDPVLEGLVRAKQDLLDHGSIDSDGQRAFSVVPLMLHGDAAFAGQGVVAE  660
			  	661  TLNLANLPGYRVGGTIHIIVNNQIGFTTAPEYSRSSEYCTDVAKMIGAPIFHVNGDDPEA  720
			  	721  CVWVARLAVDFRQRFKKDVVIDMLCYRRRGHNEGDDPSMTNPYVYDVVDTKRGARKSYTE  780
			  	781  ALIGRGDISMKEAEDALRDYQGQLERVFNEVRELEKHGVQPSESVESDQMIPAGLATAVD  840
			  	841  KSLLARIGDAFLALPNGFTAHPRVQPVLEKRREMAYEGKIDWAFGELLALGSLVAEGKLV  900
			  	901  RLSGQDSRRGTFSQRHSVLIDRHTGEEFTPLQLLATNSDGSPTGGKFLVYDSPLSEYAAV  960
			  	961  GFEYGYTVGNPDAVVLWEAQFGDFVNGAQSIIDEFISSGEAKWGQLSNVVLLLPHGHEGQ 1020
			  	1021 GPDHTSARIERFLQLWAEGSMTIAMPSTPSNYFHLLRRHALDGIQRPLIVFTPKSMLRHK 1080
			  	1081 AAVSEIKDFTEIKFRSVLEEPTYEDGIGDRNKVSRILLTSGKLYYELAARKAKDNRNDLA 1140
			  	1141 IVRLEQLAPLPRRRLRETLDRYENVKEFFWVQEEPANQGAWPRFGLELPELLPDKLAGIK 1200
			  	1201 RISRRAMSAPSSGSSKVHAVEQQEILDEAFG

Known structures in the PDB

No Known structures

Number of amino acids : 1231

Domains assigned based on sequence.

Mtb Structural proteome models

CHOPIN models

Profile-based domain assignment

Structural/Functional domain family	Pfam acc.no./SCOP ID	Domain Region
2-oxoacid_dh	PF00198	99-341
E1_dh	PF00676	486-820
Transket_pyr	PF02779	878-1080

Mtb Structural Proteome models

Model Number	1
Model name	Rv1248c
Template	1UMD BPDB CREDO
Template coverage	4_318
Template Identity(%)	20.3
Model coverage(%)	28.7
Normalized DOPE score	-0.279

Model Number	2
Model name	Rv1248c.2
Template	1SCZ APDB CREDO
Template coverage	172_400
Template Identity(%)	25.8
Model coverage(%)	19.9
Normalized DOPE score	-0.094

Model Number	3
Model name	Rv1248c.4
Template	1UMD APDB CREDO
Template coverage	7_367
Template Identity(%)	17.5
Model coverage(%)	32.8
Normalized DOPE score	0.382

Model Number	4
Model name	Rv1248c.1
Template	1EAF APDB CREDO
Template coverage	396_635
Template Identity(%)	20.8
Model coverage(%)	20.8
Normalized DOPE score	0.557

Model Number	5
Model name	Rv1248c.3
Template	2BFD APDB CREDO
Template coverage	13_400
Template Identity(%)	12.5
Model coverage(%)	36.8
Normalized DOPE score	0.906

Structure Models from Chopin

Model Number	1
Profile	c.43.1.1 - 3.30.559.10 Click for model details
zscore	15.26
Residue begin	69
Residue end	328

Model Number	2
Profile	c.36.1.7 Click for model details
zscore	11.89
Residue begin	853
Residue end	1084

Binding pockets

STRING

Cytoscape Web will replace the contents of this div with protein-protein interaction network.

Protein interacting with Rv1248c	Gene name	Confidence Score
Rv2215	dlaT	0.996
Rv2215	dlaT	0.996
Rv2215	dlaT	0.996
Rv0951	sucC	0.993
Rv0952	sucD	0.993
Rv0462	lpdC	0.993
Rv0952	sucD	0.993
Rv0462	lpdC	0.993
Rv0462	lpdC	0.993
Rv0951	sucC	0.993
Rv2495c	bkdC	0.982
Rv2495c	bkdC	0.982
Rv2495c	bkdC	0.982
Rv0896	gltA2	0.977
Rv1308	atpA	0.969
Rv1308	atpA	0.969
Rv1308	atpA	0.969
Rv3319	sdhB	0.951
Rv3319	sdhB	0.951
Rv1310	atpD	0.949
Rv1310	atpD	0.949
Rv1310	atpD	0.949
Rv2241	aceE	0.935
Rv3318	sdhA	0.924
Rv3318	sdhA	0.924
Rv2713	sthA	0.914
Rv2713	sthA	0.914
Rv2713	sthA	0.914
Rv1475c	acn	0.914
Rv1475c	acn	0.914
Rv3846	sodA	0.912
Rv3846	sodA	0.912
Rv1240	mdh	0.91
Rv1240	mdh	0.91

Potential ligand/drug binding sites

Protein Model	Pocket Number	Drug Binding Site	PMIN Score	Pvalue PMIN	PMAX Score	Pvalue PMAX
Rv1248c.1	11	1sa1_POD_B_700 PDB CREDO	0.693	0.086	0.693	0.000
Rv1248c.1	11	1sa1_POD_D_701 PDB CREDO	0.704	0.078	0.683	0.000
Rv1248c.1	4	1fm6_BRL_D_503 PDB CREDO	0.668	0.108	0.668	0.001
Rv1248c.1	4	3jwq_VIA_D_901 PDB CREDO	0.707	0.076	0.659	0.001
Rv1248c.1	4	2prg_BRL_A_1 PDB CREDO	0.657	0.118	0.657	0.001
Rv1248c.1	4	3jwq_VIA_B_901 PDB CREDO	0.677	0.099	0.654	0.001
Rv1248c.1	4	1ya3_STR_B_2001 PDB CREDO	0.677	0.100	0.653	0.001
Rv1248c.1	4	1ya3_STR_A_1001 PDB CREDO	0.676	0.100	0.653	0.001
Rv1248c.1	11	3spk_TPV_B_100 PDB CREDO	0.672	0.104	0.652	0.001
Rv1248c.1	11	3e22_LOC_D_700 PDB CREDO	0.737	0.056	0.652	0.001
Rv1248c.1	11	3e22_LOC_B_700 PDB CREDO	0.736	0.056	0.651	0.001
Rv1248c.1	11	1n49_RIT_D_401 PDB CREDO	0.684	0.093	0.646	0.001
Rv1248c.1	4	2xpv_MIY_A_1209 PDB CREDO	0.644	0.130	0.644	0.001
Rv1248c.2	2	3adx_IMN_B_3 PDB CREDO	0.641	0.134	0.641	0.001
Rv1248c.1	4	1ya3_STR_C_3001 PDB CREDO	0.687	0.091	0.639	0.001
Rv1248c.2	2	2w8y_NDR_B_1000 PDB CREDO	0.663	0.112	0.637	0.001
Rv1248c.1	4	1zgy_BRL_A_503 PDB CREDO	0.704	0.078	0.634	0.001
Rv1248c.4	3	1hwi_115_A_2 PDB CREDO	0.653	0.122	0.631	0.001
Rv1248c.1	4	3h52_486_C_4 PDB CREDO	0.653	0.121	0.630	0.001
Rv1248c.1	4	2h42_VIA_A_901 PDB CREDO	0.675	0.101	0.630	0.001
Rv1248c.1	4	2h77_T3_A_1 PDB CREDO	0.697	0.083	0.629	0.001
Rv1248c.1	4	3qt0_486_A_4 PDB CREDO	0.672	0.104	0.627	0.001
Rv1248c.1	4	3h0a_9RA_A_500 PDB CREDO	0.667	0.108	0.622	0.001
Rv1248c.1	4	2h79_T3_A_1 PDB CREDO	0.712	0.072	0.621	0.001
Rv1248c.1	4	2h42_VIA_C_903 PDB CREDO	0.640	0.134	0.618	0.002
Rv1248c.1	11	3ut5_LOC_B_502 PDB CREDO	0.655	0.120	0.617	0.002
Rv1248c.1	4	2q1v_PDN_A_248 PDB CREDO	0.638	0.137	0.616	0.002
Rv1248c.1	4	1bsx_T3_A_1 PDB CREDO	0.729	0.060	0.616	0.002
Rv1248c.1	4	1bsx_T3_B_2 PDB CREDO	0.729	0.060	0.616	0.002
Rv1248c.1	4	1s9p_DES_A_459 PDB CREDO	0.615	0.161	0.615	0.002
Rv1248c.1	4	3gws_T3_X_500 PDB CREDO	0.728	0.061	0.614	0.002
Rv1248c.1	4	3ln1_CEL_D_682 PDB CREDO	0.654	0.121	0.610	0.002
Rv1248c.2	2	3ri5_IVM_E_349 PDB CREDO	0.633	0.142	0.608	0.002
Rv1248c.1	4	1p93_DEX_B_2999 PDB CREDO	0.652	0.123	0.608	0.002
Rv1248c.1	4	2xkw_P1B_B_1475 PDB CREDO	0.630	0.145	0.608	0.002
Rv1248c.2	2	1ya3_STR_C_3001 PDB CREDO	0.736	0.056	0.607	0.002
Rv1248c.2	2	1ya4_CTX_C_3 PDB CREDO	0.632	0.143	0.607	0.002
Rv1248c.1	11	3gcs_BAX_A_401 PDB CREDO	0.607	0.171	0.607	0.002
Rv1248c.1	11	3ut5_LOC_D_502 PDB CREDO	0.685	0.093	0.606	0.002
Rv1248c.1	4	1p93_DEX_A_1999 PDB CREDO	0.649	0.125	0.605	0.002
Rv1248c.1	4	3bbt_FMM_D_91 PDB CREDO	0.649	0.125	0.605	0.002
Rv1248c.1	4	1a28_STR_A_1 PDB CREDO	0.604	0.174	0.604	0.002
Rv1248c.1	4	3uvv_T3_A_501 PDB CREDO	0.739	0.054	0.604	0.002
Rv1248c.4	3	1hwi_115_C_4 PDB CREDO	0.646	0.128	0.603	0.002
Rv1248c.1	4	2aax_PDN_A_502 PDB CREDO	0.692	0.087	0.603	0.002
Rv1248c.2	2	2ayl_FLP_B_2701 PDB CREDO	0.628	0.148	0.602	0.002
Rv1248c.1	4	2aax_PDN_B_503 PDB CREDO	0.690	0.088	0.602	0.002
Rv1248c.4	3	1hwi_115_B_1 PDB CREDO	0.685	0.092	0.602	0.002
Rv1248c.1	4	2aa6_STR_B_402 PDB CREDO	0.690	0.089	0.602	0.002
Rv1248c.2	2	3sxr_1N1_B_2 PDB CREDO	0.602	0.177	0.602	0.002
Rv1248c.2	2	1mx1_THA_D_4 PDB CREDO	0.626	0.149	0.602	0.002
Rv1248c.1	4	1xzx_T3_X_500 PDB CREDO	0.735	0.057	0.601	0.002
Rv1248c.1	4	2aa6_STR_A_401 PDB CREDO	0.687	0.091	0.599	0.002
Rv1248c.2	2	1ya4_CTX_B_2 PDB CREDO	0.624	0.152	0.599	0.002
Rv1248c.1	4	2prg_BRL_B_2 PDB CREDO	0.599	0.180	0.599	0.002
Rv1248c.1	11	1n49_RIT_B_301 PDB CREDO	0.690	0.089	0.598	0.002
Rv1248c.4	3	1hwi_115_D_3 PDB CREDO	0.681	0.096	0.598	0.002
Rv1248c.1	2	3mdv_CL6_A_506 PDB CREDO	0.597	0.182	0.597	0.002
Rv1248c.2	2	3ri5_IVM_B_349 PDB CREDO	0.672	0.104	0.597	0.002
Rv1248c.2	2	3h52_486_C_4 PDB CREDO	0.749	0.048	0.596	0.002
Rv1248c.1	4	1nhz_486_A_800 PDB CREDO	0.661	0.114	0.596	0.002
Rv1248c.2	2	3ri5_IVM_D_349 PDB CREDO	0.670	0.105	0.596	0.002
Rv1248c.2	2	3rif_IVM_E_402 PDB CREDO	0.670	0.105	0.596	0.002
Rv1248c.2	2	3sxr_1N1_A_1 PDB CREDO	0.620	0.156	0.595	0.002
Rv1248c.1	11	3so9_017_A_100 PDB CREDO	0.632	0.143	0.595	0.002
Rv1248c.1	4	3ri5_IVM_C_350 PDB CREDO	0.616	0.160	0.595	0.002
Rv1248c.1	4	3rif_IVM_A_402 PDB CREDO	0.616	0.160	0.595	0.002
Rv1248c.1	4	3rif_IVM_B_403 PDB CREDO	0.616	0.160	0.595	0.002
Rv1248c.1	11	3h52_486_B_1 PDB CREDO	0.612	0.164	0.594	0.002
Rv1248c.2	2	3rhw_IVM_B_348 PDB CREDO	0.669	0.107	0.594	0.002
Rv1248c.2	2	3ria_IVM_A_348 PDB CREDO	0.669	0.107	0.594	0.002
Rv1248c.1	11	1xkk_FMM_A_91 PDB CREDO	0.783	0.032	0.594	0.002
Rv1248c.1	4	3ria_IVM_C_349 PDB CREDO	0.616	0.161	0.594	0.002
Rv1248c.2	2	3rhw_IVM_D_349 PDB CREDO	0.668	0.108	0.594	0.002
Rv1248c.1	11	3heg_BAX_A_1 PDB CREDO	0.611	0.165	0.594	0.002
Rv1248c.1	4	1sqn_NDR_A_1001 PDB CREDO	0.593	0.187	0.593	0.002
Rv1248c.2	2	3rhw_IVM_D_348 PDB CREDO	0.667	0.108	0.593	0.002
Rv1248c.2	2	3ria_IVM_C_350 PDB CREDO	0.667	0.108	0.593	0.002
Rv1248c.1	4	3rif_IVM_D_402 PDB CREDO	0.614	0.162	0.593	0.002
Rv1248c.2	2	1a27_EST_A_350 PDB CREDO	0.641	0.134	0.592	0.002
Rv1248c.2	2	3rhw_IVM_B_349 PDB CREDO	0.664	0.111	0.591	0.002
Rv1248c.2	2	2h42_VIA_C_903 PDB CREDO	0.742	0.052	0.590	0.003
Rv1248c.2	2	1jip_KTN_A_801 PDB CREDO	0.615	0.162	0.590	0.003
Rv1248c.2	2	1uho_VDN_A_1000 PDB CREDO	0.641	0.133	0.590	0.003
Rv1248c.2	2	3ria_IVM_E_348 PDB CREDO	0.664	0.111	0.590	0.003
Rv1248c.2	2	1mx1_THA_A_1 PDB CREDO	0.638	0.136	0.588	0.003
Rv1248c.1	4	3rif_IVM_A_403 PDB CREDO	0.609	0.168	0.588	0.003
Rv1248c.4	3	2a69_RPT_M_8002 PDB CREDO	0.588	0.194	0.588	0.003
Rv1248c.1	11	3h52_486_A_3 PDB CREDO	0.624	0.152	0.587	0.003
Rv1248c.1	4	1sqn_NDR_B_2001 PDB CREDO	0.587	0.195	0.587	0.003
Rv1248c.1	2	3ndv_AIC_D_374 PDB CREDO	0.587	0.195	0.587	0.003
Rv1248c.2	2	1a28_STR_A_1 PDB CREDO	0.764	0.040	0.586	0.003
Rv1248c.1	4	3spk_TPV_A_100 PDB CREDO	0.650	0.124	0.586	0.003
Rv1248c.2	2	1mx1_THA_F_6 PDB CREDO	0.610	0.167	0.586	0.003
Rv1248c.2	2	2q1v_PDN_A_248 PDB CREDO	0.790	0.029	0.586	0.003
Rv1248c.1	4	1fm6_BRL_X_504 PDB CREDO	0.716	0.069	0.585	0.003
Rv1248c.1	11	3h52_486_D_2 PDB CREDO	0.621	0.155	0.584	0.003
Rv1248c.1	4	2aa5_STR_B_302 PDB CREDO	0.670	0.106	0.584	0.003
Rv1248c.1	4	3e22_LOC_B_700 PDB CREDO	0.737	0.055	0.584	0.003
Rv1248c.4	3	1hwk_117_D_3 PDB CREDO	0.707	0.075	0.584	0.003
Rv1248c.1	4	3oht_1N1_B_1000 PDB CREDO	0.583	0.200	0.583	0.003
Rv1248c.1	4	2aa5_STR_A_301 PDB CREDO	0.668	0.108	0.583	0.003
Rv1248c.1	11	4asd_BAX_A_1500 PDB CREDO	0.582	0.201	0.582	0.003
Rv1248c.2	2	1ya3_STR_A_1001 PDB CREDO	0.785	0.030	0.582	0.003
Rv1248c.1	4	3e22_LOC_D_700 PDB CREDO	0.735	0.057	0.582	0.003
Rv1248c.1	2	3ndv_AIC_B_376 PDB CREDO	0.581	0.202	0.581	0.003
Rv1248c.2	2	3n8z_FLP_B_1701 PDB CREDO	0.581	0.202	0.581	0.003
Rv1248c.2	2	3ls4_TCI_H_220 PDB CREDO	0.605	0.173	0.581	0.003
Rv1248c.4	3	1hwl_FBI_A_2 PDB CREDO	0.725	0.063	0.581	0.003
Rv1248c.1	4	1jg2_ADN_A_500 PDB CREDO	0.601	0.178	0.580	0.003
Rv1248c.2	2	3ri5_IVM_A_349 PDB CREDO	0.652	0.122	0.580	0.003
Rv1248c.4	3	1hwl_FBI_C_4 PDB CREDO	0.723	0.064	0.579	0.003
Rv1248c.2	2	3rhw_IVM_A_348 PDB CREDO	0.651	0.124	0.578	0.003
Rv1248c.2	2	1ya3_STR_B_2001 PDB CREDO	0.780	0.033	0.578	0.003
Rv1248c.4	3	1hwl_FBI_D_3 PDB CREDO	0.722	0.065	0.578	0.003
Rv1248c.1	4	2h42_VIA_B_902 PDB CREDO	0.599	0.181	0.578	0.003
Rv1248c.4	3	1hwl_FBI_B_1 PDB CREDO	0.721	0.066	0.577	0.003
Rv1248c.1	4	1mx1_THA_C_3 PDB CREDO	0.576	0.208	0.576	0.003
Rv1248c.1	4	3frq_ERY_B_195 PDB CREDO	0.728	0.061	0.576	0.003
Rv1248c.1	11	3ogp_017_A_200 PDB CREDO	0.594	0.186	0.576	0.003
Rv1248c.2	2	3ria_IVM_E_349 PDB CREDO	0.648	0.126	0.576	0.003
Rv1248c.1	4	3cs8_BRL_A_503 PDB CREDO	0.720	0.066	0.575	0.003
Rv1248c.2	2	2uxo_TAC_B_1211 PDB CREDO	0.575	0.211	0.575	0.003
Rv1248c.2	2	3nt1_NPS_A_5 PDB CREDO	0.575	0.211	0.575	0.003
Rv1248c.1	11	1jg2_ADN_A_500 PDB CREDO	0.792	0.028	0.575	0.003
Rv1248c.2	2	1p93_DEX_B_2999 PDB CREDO	0.802	0.024	0.575	0.003
Rv1248c.1	11	3lzv_017_A_200 PDB CREDO	0.644	0.130	0.574	0.003
Rv1248c.1	11	2qxs_RAL_B_600 PDB CREDO	0.680	0.097	0.574	0.003
Rv1248c.2	2	3nt1_NPS_B_4 PDB CREDO	0.573	0.213	0.573	0.003
Rv1248c.2	2	1p93_DEX_A_1999 PDB CREDO	0.800	0.025	0.573	0.003
Rv1248c.1	11	3spk_TPV_A_100 PDB CREDO	0.737	0.056	0.572	0.003
Rv1248c.1	4	3bbt_FMM_B_91 PDB CREDO	0.663	0.112	0.572	0.003
Rv1248c.2	2	2h42_VIA_B_902 PDB CREDO	0.718	0.067	0.571	0.004
Rv1248c.1	4	1p93_DEX_D_4999 PDB CREDO	0.677	0.100	0.571	0.004
Rv1248c.1	4	3gn8_DEX_B_247 PDB CREDO	0.677	0.100	0.571	0.004
Rv1248c.1	2	3ndv_AIC_A_375 PDB CREDO	0.598	0.181	0.571	0.004
Rv1248c.1	11	3bbt_FMM_D_91 PDB CREDO	0.760	0.043	0.571	0.004
Rv1248c.1	4	1m2z_DEX_A_301 PDB CREDO	0.675	0.101	0.570	0.004
Rv1248c.2	2	1xp0_VDN_A_201 PDB CREDO	0.646	0.129	0.570	0.004
Rv1248c.2	2	3bbt_FMM_B_91 PDB CREDO	0.641	0.134	0.570	0.004
Rv1248c.1	4	1gs4_ZK5_A_1918 PDB CREDO	0.590	0.191	0.570	0.004
Rv1248c.2	2	1sqn_NDR_B_2001 PDB CREDO	0.742	0.052	0.570	0.004
Rv1248c.1	4	3mne_DEX_A_784 PDB CREDO	0.675	0.101	0.570	0.004
Rv1248c.1	4	1p93_DEX_C_3999 PDB CREDO	0.674	0.102	0.568	0.004
Rv1248c.1	11	2qxs_RAL_A_600 PDB CREDO	0.673	0.103	0.568	0.004
Rv1248c.1	4	1m2z_DEX_D_401 PDB CREDO	0.672	0.104	0.567	0.004
Rv1248c.2	2	1cqe_FLP_B_2650 PDB CREDO	0.643	0.131	0.567	0.004
Rv1248c.1	4	3gn8_DEX_A_247 PDB CREDO	0.672	0.104	0.567	0.004
Rv1248c.2	2	1cqe_FLP_A_1650 PDB CREDO	0.642	0.132	0.567	0.004
Rv1248c.1	11	1uwh_BAX_A_1723 PDB CREDO	0.601	0.177	0.566	0.004
Rv1248c.2	2	3ads_IMN_B_3 PDB CREDO	0.641	0.133	0.566	0.004
Rv1248c.1	11	1uwh_BAX_B_1723 PDB CREDO	0.600	0.178	0.565	0.004
Rv1248c.1	11	1t46_STI_A_3 PDB CREDO	0.707	0.075	0.565	0.004
Rv1248c.1	4	2ab2_SNL_B_503 PDB CREDO	0.714	0.071	0.565	0.004
Rv1248c.2	2	3rif_IVM_D_402 PDB CREDO	0.710	0.073	0.565	0.004
Rv1248c.2	2	2ayl_FLP_A_1701 PDB CREDO	0.611	0.166	0.565	0.004
Rv1248c.2	2	3kw2_ADN_B_300 PDB CREDO	0.588	0.194	0.565	0.004
Rv1248c.2	2	1sqn_NDR_A_1001 PDB CREDO	0.736	0.056	0.565	0.004
Rv1248c.4	3	1hwk_117_C_4 PDB CREDO	0.727	0.062	0.565	0.004
Rv1248c.1	4	2oax_SNL_C_3001 PDB CREDO	0.713	0.071	0.564	0.004
Rv1248c.2	2	3ri5_IVM_C_350 PDB CREDO	0.709	0.074	0.564	0.004
Rv1248c.1	2	1bx4_ADN_A_350 PDB CREDO	0.617	0.159	0.564	0.004
Rv1248c.1	4	2oax_SNL_B_2001 PDB CREDO	0.712	0.072	0.564	0.004
Rv1248c.1	4	1jg3_ADN_A_500 PDB CREDO	0.606	0.172	0.564	0.004
Rv1248c.2	2	1eqh_FLP_A_701 PDB CREDO	0.638	0.136	0.563	0.004
Rv1248c.1	4	2hw2_RFP_A_1200 PDB CREDO	0.711	0.072	0.563	0.004
Rv1248c.2	2	3ria_IVM_C_349 PDB CREDO	0.708	0.075	0.563	0.004
Rv1248c.2	2	3rif_IVM_A_402 PDB CREDO	0.708	0.075	0.563	0.004
Rv1248c.4	3	1hwk_117_A_2 PDB CREDO	0.724	0.063	0.563	0.004
Rv1248c.4	3	1ynn_RFP_C_1120 PDB CREDO	0.647	0.128	0.563	0.004
Rv1248c.1	4	3oct_1N1_A_663 PDB CREDO	0.583	0.200	0.563	0.004
Rv1248c.2	2	1eqh_FLP_B_1701 PDB CREDO	0.637	0.137	0.562	0.004
Rv1248c.1	2	3ndv_AIC_C_375 PDB CREDO	0.589	0.192	0.562	0.004
Rv1248c.2	2	3jwq_VIA_B_901 PDB CREDO	0.707	0.075	0.562	0.004
Rv1248c.1	4	3vhu_SNL_A_1001 PDB CREDO	0.710	0.073	0.562	0.004
Rv1248c.1	4	2ab2_SNL_A_502 PDB CREDO	0.709	0.074	0.562	0.004
Rv1248c.1	2	2bxf_DZP_A_2001 PDB CREDO	0.561	0.228	0.561	0.004
Rv1248c.2	2	3rif_IVM_B_403 PDB CREDO	0.705	0.077	0.561	0.004
Rv1248c.1	4	3rif_IVM_E_402 PDB CREDO	0.649	0.126	0.560	0.004
Rv1248c.1	4	3rhw_IVM_D_349 PDB CREDO	0.648	0.126	0.560	0.004
Rv1248c.1	4	3ri5_IVM_A_349 PDB CREDO	0.648	0.126	0.560	0.004
Rv1248c.1	11	3frq_ERY_A_195 PDB CREDO	0.576	0.209	0.559	0.004
Rv1248c.1	2	2bxf_DZP_B_2001 PDB CREDO	0.559	0.231	0.559	0.004
Rv1248c.1	4	3rhw_IVM_A_348 PDB CREDO	0.647	0.127	0.559	0.004
Rv1248c.1	11	1uwj_BAX_B_1723 PDB CREDO	0.558	0.232	0.558	0.004
Rv1248c.2	2	3b2r_VDN_A_1 PDB CREDO	0.691	0.088	0.558	0.004
Rv1248c.1	11	3el0_1UN_A_201 PDB CREDO	0.626	0.149	0.558	0.004
Rv1248c.1	4	3ria_IVM_A_348 PDB CREDO	0.647	0.128	0.558	0.004
Rv1248c.2	2	2h42_VIA_A_901 PDB CREDO	0.780	0.033	0.558	0.004
Rv1248c.1	11	1err_RAL_A_600 PDB CREDO	0.611	0.166	0.558	0.004
Rv1248c.1	11	1err_RAL_B_600 PDB CREDO	0.611	0.166	0.558	0.004
Rv1248c.1	4	3adx_IMN_B_3 PDB CREDO	0.727	0.062	0.558	0.004
Rv1248c.1	4	3ri5_IVM_B_349 PDB CREDO	0.646	0.129	0.558	0.004
Rv1248c.1	11	3gp0_NIL_A_1 PDB CREDO	0.716	0.069	0.557	0.004
Rv1248c.1	4	3rhw_IVM_B_348 PDB CREDO	0.645	0.129	0.557	0.004
Rv1248c.1	4	3rhw_IVM_B_349 PDB CREDO	0.645	0.129	0.557	0.004
Rv1248c.1	4	3rhw_IVM_D_348 PDB CREDO	0.645	0.129	0.557	0.004
Rv1248c.2	2	1mx1_THA_C_3 PDB CREDO	0.726	0.062	0.557	0.004
Rv1248c.1	4	3ria_IVM_E_348 PDB CREDO	0.644	0.130	0.556	0.005
Rv1248c.1	11	2nni_MTK_A_501 PDB CREDO	0.573	0.213	0.556	0.005
Rv1248c.1	4	3o1c_ADN_A_127 PDB CREDO	0.597	0.182	0.556	0.005
Rv1248c.1	4	3ri5_IVM_D_349 PDB CREDO	0.644	0.131	0.556	0.005
Rv1248c.1	4	3ria_IVM_C_350 PDB CREDO	0.644	0.131	0.556	0.005
Rv1248c.2	2	1jin_KTN_A_801 PDB CREDO	0.578	0.206	0.555	0.005
Rv1248c.1	4	3ria_IVM_E_349 PDB CREDO	0.643	0.131	0.555	0.005
Rv1248c.2	2	1mrl_DOL_A_300 PDB CREDO	0.603	0.176	0.555	0.005
Rv1248c.1	4	3d90_NOG_A_1001 PDB CREDO	0.615	0.161	0.555	0.005
Rv1248c.2	2	1mx1_THA_B_2 PDB CREDO	0.577	0.207	0.554	0.005
Rv1248c.2	2	2o7o_DXT_A_222 PDB CREDO	0.554	0.238	0.554	0.005
Rv1248c.1	4	3ln1_CEL_A_682 PDB CREDO	0.657	0.118	0.554	0.005
Rv1248c.1	4	3ln1_CEL_B_682 PDB CREDO	0.656	0.119	0.554	0.005
Rv1248c.1	11	3ogp_017_B_200 PDB CREDO	0.587	0.195	0.554	0.005
Rv1248c.2	2	3b2r_VDN_B_1 PDB CREDO	0.685	0.093	0.553	0.005
Rv1248c.1	4	3ln1_CEL_C_682 PDB CREDO	0.655	0.120	0.553	0.005
Rv1248c.1	4	3d90_NOG_B_2001 PDB CREDO	0.613	0.164	0.553	0.005
Rv1248c.1	11	2jfa_RAL_B_600 PDB CREDO	0.605	0.173	0.552	0.005
Rv1248c.1	4	2xn5_FUN_A_1356 PDB CREDO	0.719	0.067	0.552	0.005
Rv1248c.2	2	1nhz_486_A_800 PDB CREDO	0.798	0.026	0.552	0.005
Rv1248c.2	2	2trt_TAC_A_222 PDB CREDO	0.552	0.241	0.552	0.005
Rv1248c.1	4	3aod_RFP_C_2002 PDB CREDO	0.593	0.188	0.551	0.005
Rv1248c.1	4	3f4x_KLT_A_300 PDB CREDO	0.639	0.136	0.551	0.005
Rv1248c.2	2	3h0a_9RA_A_500 PDB CREDO	0.769	0.038	0.551	0.005
Rv1248c.1	4	3oht_1N1_A_1000 PDB CREDO	0.614	0.163	0.550	0.005
Rv1248c.1	4	1y0x_T44_X_500 PDB CREDO	0.739	0.054	0.550	0.005
Rv1248c.1	11	3ufn_ROC_A_401 PDB CREDO	0.705	0.077	0.549	0.005
Rv1248c.1	11	1uwj_BAX_A_1723 PDB CREDO	0.599	0.180	0.549	0.005
Rv1248c.1	2	2ydo_ADN_A_400 PDB CREDO	0.600	0.178	0.549	0.005
Rv1248c.2	2	3rif_IVM_A_403 PDB CREDO	0.690	0.089	0.549	0.005
Rv1248c.1	4	3ut5_LOC_D_502 PDB CREDO	0.693	0.086	0.549	0.005
Rv1248c.1	4	1a28_STR_B_2 PDB CREDO	0.671	0.105	0.548	0.005
Rv1248c.1	11	2hw2_RFP_A_1200 PDB CREDO	0.620	0.156	0.548	0.005
Rv1248c.1	4	3q1e_T44_C_128 PDB CREDO	0.635	0.140	0.548	0.005
Rv1248c.2	2	3mne_DEX_A_784 PDB CREDO	0.846	0.011	0.548	0.005
Rv1248c.2	2	2w9s_TOP_D_1158 PDB CREDO	0.595	0.185	0.548	0.005
Rv1248c.2	2	1fm6_BRL_D_503 PDB CREDO	0.713	0.071	0.548	0.005
Rv1248c.1	4	1s9p_DES_D_600 PDB CREDO	0.546	0.249	0.546	0.005
Rv1248c.4	3	2xpv_MIY_A_1209 PDB CREDO	0.606	0.172	0.546	0.005
Rv1248c.1	11	3sm2_478_A_126 PDB CREDO	0.758	0.044	0.546	0.005
Rv1248c.2	2	1gs4_ZK5_A_1918 PDB CREDO	0.687	0.091	0.546	0.005
Rv1248c.1	4	1cil_ETS_A_263 PDB CREDO	0.585	0.197	0.546	0.005
Rv1248c.1	4	3erd_DES_A_600 PDB CREDO	0.566	0.223	0.546	0.005
Rv1248c.2	2	1udt_VIA_A_1000 PDB CREDO	0.675	0.101	0.545	0.005
Rv1248c.2	2	3pgh_FLP_D_701 PDB CREDO	0.618	0.158	0.545	0.005
Rv1248c.2	2	1p93_DEX_C_3999 PDB CREDO	0.842	0.012	0.545	0.005
Rv1248c.2	2	2aa6_STR_B_402 PDB CREDO	0.814	0.020	0.545	0.005
Rv1248c.2	2	1mx1_THA_E_5 PDB CREDO	0.660	0.114	0.545	0.005
Rv1248c.1	4	3h52_486_D_2 PDB CREDO	0.732	0.059	0.545	0.005
Rv1248c.4	3	1hwk_117_B_1 PDB CREDO	0.743	0.052	0.545	0.005
Rv1248c.1	4	3k2h_LYA_B_514 PDB CREDO	0.544	0.252	0.544	0.005
Rv1248c.2	2	2aax_PDN_A_502 PDB CREDO	0.813	0.020	0.544	0.005
Rv1248c.2	2	2aax_PDN_B_503 PDB CREDO	0.812	0.021	0.544	0.006
Rv1248c.2	2	1m2z_DEX_D_401 PDB CREDO	0.839	0.013	0.544	0.006
Rv1248c.2	2	2prg_BRL_B_2 PDB CREDO	0.708	0.075	0.543	0.006
Rv1248c.1	11	2r5q_1UN_D_900 PDB CREDO	0.559	0.231	0.543	0.006
Rv1248c.1	11	2oiq_STI_A_1001 PDB CREDO	0.559	0.231	0.543	0.006
Rv1248c.2	5	3sm2_478_A_126 PDB CREDO	0.750	0.048	0.542	0.006
Rv1248c.1	11	2oax_SNL_F_6001 PDB CREDO	0.559	0.232	0.542	0.006
Rv1248c.2	2	2aa6_STR_A_401 PDB CREDO	0.809	0.022	0.542	0.006
Rv1248c.2	2	1m2z_DEX_A_301 PDB CREDO	0.836	0.014	0.542	0.006
Rv1248c.1	4	3ads_IMN_A_2 PDB CREDO	0.561	0.229	0.541	0.006
Rv1248c.4	3	2h77_T3_A_1 PDB CREDO	0.541	0.256	0.541	0.006
Rv1248c.1	11	1c6y_MK1_B_524 PDB CREDO	0.659	0.116	0.541	0.006
Rv1248c.1	11	2oax_SNL_A_1001 PDB CREDO	0.557	0.234	0.541	0.006
Rv1248c.1	11	2oax_SNL_D_4001 PDB CREDO	0.557	0.234	0.541	0.006
Rv1248c.1	4	2xpw_OTC_A_222 PDB CREDO	0.650	0.124	0.540	0.006
Rv1248c.2	2	2prg_BRL_A_1 PDB CREDO	0.704	0.078	0.540	0.006
Rv1248c.1	11	2qak_1UN_A_1001 PDB CREDO	0.768	0.038	0.540	0.006
Rv1248c.2	2	1s9p_DES_C_500 PDB CREDO	0.562	0.228	0.540	0.006
Rv1248c.1	11	2oax_SNL_E_5001 PDB CREDO	0.556	0.236	0.540	0.006
Rv1248c.1	11	2w8y_486_A_1000 PDB CREDO	0.540	0.259	0.540	0.006
Rv1248c.1	11	2r5q_1UN_B_900 PDB CREDO	0.555	0.237	0.539	0.006
Rv1248c.1	11	2q64_1UN_B_1001 PDB CREDO	0.767	0.039	0.539	0.006
Rv1248c.1	4	3mnp_DEX_A_784 PDB CREDO	0.702	0.079	0.538	0.006
Rv1248c.2	2	3gn8_DEX_A_247 PDB CREDO	0.831	0.015	0.538	0.006
Rv1248c.2	2	3jwq_VIA_D_901 PDB CREDO	0.752	0.047	0.538	0.006
Rv1248c.2	2	1s9p_DES_B_459 PDB CREDO	0.560	0.230	0.538	0.006
Rv1248c.1	4	3mno_DEX_A_784 PDB CREDO	0.701	0.080	0.538	0.006
Rv1248c.1	11	2pym_1UN_A_1001 PDB CREDO	0.765	0.040	0.538	0.006
Rv1248c.2	2	1udu_CIA_B_2003 PDB CREDO	0.610	0.168	0.538	0.006
Rv1248c.2	2	3gn8_DEX_B_247 PDB CREDO	0.830	0.015	0.538	0.006
Rv1248c.1	11	2pyn_1UN_A_1001 PDB CREDO	0.765	0.040	0.538	0.006
Rv1248c.2	2	1p93_DEX_D_4999 PDB CREDO	0.828	0.016	0.536	0.006
Rv1248c.2	2	3d90_NOG_B_2001 PDB CREDO	0.775	0.035	0.536	0.006
Rv1248c.1	4	2uxo_TAC_B_1211 PDB CREDO	0.698	0.082	0.536	0.006
Rv1248c.2	5	1xkk_FMM_A_91 PDB CREDO	0.780	0.033	0.536	0.006
Rv1248c.3	2	2uxo_TAC_B_1211 PDB CREDO	0.536	0.265	0.536	0.006
Rv1248c.1	4	1lhu_EST_A_301 PDB CREDO	0.535	0.265	0.535	0.006
Rv1248c.2	2	3cs8_BRL_A_503 PDB CREDO	0.557	0.235	0.535	0.006
Rv1248c.1	4	3h52_486_A_3 PDB CREDO	0.719	0.067	0.535	0.006
Rv1248c.1	4	3erd_DES_B_800 PDB CREDO	0.554	0.239	0.534	0.006
Rv1248c.1	11	2q63_1UN_A_1001 PDB CREDO	0.759	0.043	0.534	0.006
Rv1248c.1	4	1sa1_POD_B_700 PDB CREDO	0.761	0.042	0.533	0.007
Rv1248c.2	2	2aa5_STR_A_301 PDB CREDO	0.797	0.026	0.533	0.007
Rv1248c.2	2	3d90_NOG_A_1001 PDB CREDO	0.771	0.037	0.533	0.007
Rv1248c.2	2	1m17_AQ4_A_999 PDB CREDO	0.555	0.237	0.533	0.007
Rv1248c.1	4	1sa1_POD_D_701 PDB CREDO	0.738	0.055	0.533	0.007
Rv1248c.1	2	3f8w_ADN_B_301 PDB CREDO	0.533	0.269	0.533	0.007
Rv1248c.1	11	3frq_ERY_B_195 PDB CREDO	0.601	0.178	0.532	0.007
Rv1248c.1	4	1ie4_T44_B_328 PDB CREDO	0.640	0.134	0.532	0.007
Rv1248c.2	2	2aa5_STR_B_302 PDB CREDO	0.794	0.027	0.532	0.007
Rv1248c.2	2	1z9h_IMN_C_379 PDB CREDO	0.602	0.176	0.531	0.007
Rv1248c.1	11	2pl0_STI_A_200 PDB CREDO	0.547	0.248	0.531	0.007
Rv1248c.1	4	2w8y_NDR_B_1000 PDB CREDO	0.664	0.111	0.531	0.007
Rv1248c.1	4	3sxr_1N1_A_1 PDB CREDO	0.664	0.111	0.531	0.007
Rv1248c.2	2	1z9h_IMN_A_379 PDB CREDO	0.601	0.177	0.531	0.007
Rv1248c.2	5	3oxc_ROC_A_401 PDB CREDO	0.542	0.256	0.530	0.007
Rv1248c.1	4	2vke_TAC_A_222 PDB CREDO	0.638	0.137	0.530	0.007
Rv1248c.1	4	3ut5_LOC_B_502 PDB CREDO	0.712	0.072	0.530	0.007
Rv1248c.2	2	1z9h_IMN_D_476 PDB CREDO	0.600	0.179	0.530	0.007
Rv1248c.2	2	2xn5_FUN_A_1356 PDB CREDO	0.530	0.273	0.530	0.007
Rv1248c.1	2	1xot_VDN_B_102 PDB CREDO	0.530	0.273	0.530	0.007
Rv1248c.1	4	2oax_SNL_E_5001 PDB CREDO	0.733	0.058	0.529	0.007
Rv1248c.1	4	3h52_486_B_1 PDB CREDO	0.733	0.058	0.529	0.007
Rv1248c.2	2	3uud_EST_A_600 PDB CREDO	0.529	0.274	0.529	0.007
Rv1248c.1	2	3tbg_RTZ_A_2 PDB CREDO	0.581	0.203	0.529	0.007
Rv1248c.1	4	1lhv_NOG_A_301 PDB CREDO	0.647	0.128	0.528	0.007
Rv1248c.4	3	2h79_T3_A_1 PDB CREDO	0.546	0.249	0.528	0.007
Rv1248c.1	4	2oax_SNL_A_1001 PDB CREDO	0.732	0.059	0.528	0.007
Rv1248c.1	4	2o7o_DXT_A_222 PDB CREDO	0.688	0.090	0.528	0.007
Rv1248c.2	2	1z9h_IMN_B_381 PDB CREDO	0.599	0.181	0.528	0.007
Rv1248c.2	2	3ols_EST_A_600 PDB CREDO	0.528	0.275	0.528	0.007
Rv1248c.1	4	3vn2_TLS_A_501 PDB CREDO	0.688	0.090	0.528	0.007
Rv1248c.4	3	3k2h_LYA_B_514 PDB CREDO	0.585	0.197	0.528	0.007
Rv1248c.1	4	4eb6_VLB_C_503 PDB CREDO	0.547	0.249	0.528	0.007
Rv1248c.1	2	2bxe_1FL_B_2001 PDB CREDO	0.580	0.204	0.527	0.007
Rv1248c.1	4	2oax_SNL_D_4001 PDB CREDO	0.731	0.059	0.527	0.007
Rv1248c.1	4	2trt_TAC_A_222 PDB CREDO	0.687	0.091	0.527	0.007
Rv1248c.1	4	3adx_IMN_A_2 PDB CREDO	0.546	0.249	0.527	0.007
Rv1248c.2	2	3aod_RFP_C_2002 PDB CREDO	0.638	0.136	0.527	0.007
Rv1248c.1	2	2bxe_1FL_A_2001 PDB CREDO	0.578	0.206	0.526	0.007
Rv1248c.1	11	3b0w_DGX_B_1 PDB CREDO	0.590	0.191	0.526	0.007
Rv1248c.2	2	1g50_EST_A_600 PDB CREDO	0.526	0.279	0.526	0.007
Rv1248c.1	4	1z9y_FUN_A_500 PDB CREDO	0.609	0.169	0.526	0.007
Rv1248c.1	4	2oax_SNL_F_6001 PDB CREDO	0.728	0.061	0.526	0.007
Rv1248c.4	3	1uob_PNN_A_1311 PDB CREDO	0.656	0.118	0.526	0.007
Rv1248c.4	3	1cil_ETS_A_263 PDB CREDO	0.544	0.253	0.525	0.007
Rv1248c.1	11	3b0w_DGX_A_1 PDB CREDO	0.525	0.280	0.525	0.007
Rv1248c.2	2	2vke_TAC_A_222 PDB CREDO	0.568	0.219	0.525	0.007
Rv1248c.2	2	2xpw_OTC_A_222 PDB CREDO	0.568	0.219	0.525	0.007
Rv1248c.1	4	2cbr_A80_A_201 PDB CREDO	0.585	0.198	0.524	0.008
Rv1248c.1	4	4eyb_0WO_A_303 PDB CREDO	0.524	0.281	0.524	0.008
Rv1248c.2	2	2itz_IRE_A_2021 PDB CREDO	0.523	0.283	0.523	0.008
Rv1248c.2	2	2yja_EST_B_1550 PDB CREDO	0.523	0.283	0.523	0.008
Rv1248c.2	2	3pgh_FLP_B_701 PDB CREDO	0.678	0.099	0.523	0.008
Rv1248c.2	2	3uud_EST_B_600 PDB CREDO	0.523	0.283	0.523	0.008
Rv1248c.1	2	3f8w_ADN_A_300 PDB CREDO	0.523	0.283	0.523	0.008
Rv1248c.1	2	3tbg_RTZ_C_2 PDB CREDO	0.575	0.210	0.523	0.008
Rv1248c.2	2	3n8z_FLP_A_701 PDB CREDO	0.589	0.193	0.523	0.008
Rv1248c.1	4	3qgz_ADN_A_127 PDB CREDO	0.562	0.227	0.523	0.008
Rv1248c.2	2	1zgy_BRL_A_503 PDB CREDO	0.756	0.044	0.523	0.008
Rv1248c.4	3	3n58_ADN_A_500 PDB CREDO	0.580	0.204	0.523	0.008
Rv1248c.2	2	3ols_EST_B_600 PDB CREDO	0.522	0.284	0.522	0.008
Rv1248c.1	2	2ij7_TPF_F_2474 PDB CREDO	0.547	0.248	0.522	0.008
Rv1248c.2	2	1a28_STR_B_2 PDB CREDO	0.831	0.015	0.521	0.008
Rv1248c.2	2	2bxg_IBP_B_2001 PDB CREDO	0.590	0.191	0.521	0.008
Rv1248c.2	2	3vkx_T3_A_301 PDB CREDO	0.741	0.053	0.521	0.008
Rv1248c.1	4	1ict_T44_D_129 PDB CREDO	0.652	0.123	0.521	0.008
Rv1248c.1	11	3ekq_ROC_A_100 PDB CREDO	0.617	0.159	0.521	0.008
Rv1248c.4	3	2a69_RPT_C_8001 PDB CREDO	0.644	0.131	0.520	0.008
Rv1248c.1	11	3ogq_AB1_A_200 PDB CREDO	0.704	0.078	0.520	0.008
Rv1248c.1	4	1hwi_115_A_2 PDB CREDO	0.596	0.183	0.520	0.008
Rv1248c.1	11	1hwk_117_B_1 PDB CREDO	0.551	0.242	0.520	0.008
Rv1248c.1	4	1ya4_CTX_B_2 PDB CREDO	0.651	0.123	0.520	0.008
Rv1248c.2	2	3axz_ADN_A_401 PDB CREDO	0.615	0.161	0.520	0.008
Rv1248c.2	2	3hbb_TMQ_C_613 PDB CREDO	0.615	0.161	0.520	0.008
Rv1248c.1	11	3cs9_NIL_A_600 PDB CREDO	0.600	0.179	0.520	0.008
Rv1248c.2	2	3clb_TMQ_A_611 PDB CREDO	0.614	0.162	0.519	0.008
Rv1248c.1	2	3mdv_CL6_B_506 PDB CREDO	0.599	0.180	0.519	0.008
Rv1248c.1	4	3o1x_ADN_A_1450 PDB CREDO	0.538	0.262	0.519	0.008
Rv1248c.1	4	3ri5_IVM_E_349 PDB CREDO	0.649	0.125	0.519	0.008
Rv1248c.2	2	2xrl_DXT_A_1211 PDB CREDO	0.587	0.194	0.518	0.008
Rv1248c.1	11	2jfa_RAL_A_600 PDB CREDO	0.585	0.197	0.518	0.008
Rv1248c.1	4	2y6o_1N1_A_1892 PDB CREDO	0.633	0.141	0.518	0.008
Rv1248c.2	2	3tmz_06X_A_503 PDB CREDO	0.586	0.196	0.518	0.008
Rv1248c.2	5	1ya4_CTX_A_1 PDB CREDO	0.664	0.112	0.517	0.008
Rv1248c.1	4	3ads_IMN_B_3 PDB CREDO	0.762	0.041	0.516	0.009
Rv1248c.1	11	3oez_STI_A_601 PDB CREDO	0.547	0.248	0.516	0.009
Rv1248c.1	2	2jap_J01_B_1249 PDB CREDO	0.567	0.221	0.516	0.009
Rv1248c.1	4	1mx1_THA_E_5 PDB CREDO	0.554	0.238	0.516	0.009
Rv1248c.1	4	3tkd_CYZ_A_266 PDB CREDO	0.651	0.123	0.515	0.009
Rv1248c.1	11	1jg3_ADN_A_500 PDB CREDO	0.791	0.028	0.515	0.009
Rv1248c.1	11	1t7j_478_A_200 PDB CREDO	0.547	0.248	0.515	0.009
Rv1248c.1	4	3tkd_CYZ_B_267 PDB CREDO	0.692	0.087	0.515	0.009
Rv1248c.2	2	1fj8_CER_D_500 PDB CREDO	0.559	0.231	0.515	0.009
Rv1248c.1	4	1ya4_CTX_C_3 PDB CREDO	0.645	0.130	0.515	0.009
Rv1248c.2	5	2q64_1UN_B_1001 PDB CREDO	0.695	0.085	0.515	0.009
Rv1248c.1	11	3d91_REM_B_350 PDB CREDO	0.515	0.295	0.515	0.009
Rv1248c.4	3	3tkd_CYZ_A_266 PDB CREDO	0.586	0.196	0.514	0.009
Rv1248c.2	5	2pym_1UN_A_1001 PDB CREDO	0.694	0.086	0.514	0.009
Rv1248c.1	4	1jg3_ADN_B_550 PDB CREDO	0.618	0.158	0.514	0.009
Rv1248c.1	4	2ito_IRE_A_2020 PDB CREDO	0.595	0.185	0.514	0.009
Rv1248c.1	4	3k54_1N1_A_1 PDB CREDO	0.552	0.241	0.514	0.009
Rv1248c.1	2	2jap_J01_C_1249 PDB CREDO	0.564	0.224	0.514	0.009
Rv1248c.2	2	2cbr_A80_A_201 PDB CREDO	0.600	0.179	0.514	0.009
Rv1248c.1	11	3d91_REM_A_350 PDB CREDO	0.513	0.298	0.513	0.009
Rv1248c.2	2	3qt0_486_A_4 PDB CREDO	0.717	0.069	0.513	0.009
Rv1248c.2	2	2xkw_P1B_B_1475 PDB CREDO	0.645	0.129	0.513	0.009
Rv1248c.2	5	2qak_1UN_A_1001 PDB CREDO	0.692	0.087	0.513	0.009
Rv1248c.1	11	2o4n_TPV_A_300 PDB CREDO	0.545	0.252	0.513	0.009
Rv1248c.2	5	2q63_1UN_A_1001 PDB CREDO	0.691	0.088	0.512	0.009
Rv1248c.4	3	3gws_T3_X_500 PDB CREDO	0.547	0.248	0.512	0.009
Rv1248c.1	2	2jap_J01_D_1249 PDB CREDO	0.562	0.227	0.512	0.009
Rv1248c.2	5	2pyn_1UN_A_1001 PDB CREDO	0.690	0.088	0.512	0.009
Rv1248c.2	2	3vri_1KX_A_301 PDB CREDO	0.532	0.269	0.511	0.009
Rv1248c.4	3	1bsx_T3_A_1 PDB CREDO	0.546	0.249	0.511	0.009
Rv1248c.4	3	1bsx_T3_B_2 PDB CREDO	0.546	0.249	0.511	0.009
Rv1248c.4	3	4eyb_0WO_A_303 PDB CREDO	0.567	0.221	0.511	0.009
Rv1248c.1	4	1oq5_CEL_A_701 PDB CREDO	0.530	0.273	0.511	0.009
Rv1248c.2	2	2fum_MIX_B_1539 PDB CREDO	0.511	0.301	0.511	0.009
Rv1248c.2	2	2jap_J01_B_1249 PDB CREDO	0.727	0.062	0.511	0.009
Rv1248c.1	4	3frq_ERY_A_195 PDB CREDO	0.751	0.047	0.511	0.009
Rv1248c.2	2	2bxf_DZP_B_2001 PDB CREDO	0.661	0.114	0.510	0.009
Rv1248c.2	5	2aof_FRD_C_305 PDB CREDO	0.610	0.167	0.510	0.009
Rv1248c.2	2	2ito_IRE_A_2020 PDB CREDO	0.574	0.212	0.510	0.009
Rv1248c.1	4	3b0w_DGX_A_1 PDB CREDO	0.728	0.061	0.510	0.009
Rv1248c.2	2	3ln1_CEL_D_682 PDB CREDO	0.712	0.072	0.510	0.009
Rv1248c.1	4	3sxr_1N1_B_2 PDB CREDO	0.664	0.111	0.509	0.009
Rv1248c.2	2	1s9p_DES_A_459 PDB CREDO	0.664	0.111	0.509	0.009
Rv1248c.2	2	2ij7_TPF_F_2474 PDB CREDO	0.691	0.088	0.509	0.009
Rv1248c.2	2	3bbt_FMM_D_91 PDB CREDO	0.710	0.073	0.508	0.010
Rv1248c.1	11	1hsh_MK1_A_401 PDB CREDO	0.619	0.157	0.508	0.010
Rv1248c.1	2	2jap_J01_A_1249 PDB CREDO	0.559	0.232	0.508	0.010
Rv1248c.1	4	1s9p_DES_B_459 PDB CREDO	0.636	0.139	0.508	0.010
Rv1248c.1	2	2w9s_TOP_F_1159 PDB CREDO	0.532	0.270	0.508	0.010
Rv1248c.2	2	2xpv_MIY_A_1209 PDB CREDO	0.661	0.114	0.508	0.010
Rv1248c.2	2	3vhu_SNL_A_1001 PDB CREDO	0.835	0.014	0.507	0.010
Rv1248c.4	3	3frq_ERY_B_195 PDB CREDO	0.578	0.206	0.507	0.010
Rv1248c.1	2	3g0f_B49_B_9001 PDB CREDO	0.507	0.307	0.507	0.010
Rv1248c.1	11	1y0x_T44_X_500 PDB CREDO	0.538	0.260	0.507	0.010
Rv1248c.1	11	2aoh_FRD_C_305 PDB CREDO	0.522	0.284	0.507	0.010
Rv1248c.2	2	2ab2_SNL_B_503 PDB CREDO	0.834	0.014	0.507	0.010
Rv1248c.2	2	1fj8_CER_B_500 PDB CREDO	0.551	0.243	0.507	0.010
Rv1248c.2	2	1jg3_ADN_B_550 PDB CREDO	0.549	0.246	0.507	0.010
Rv1248c.4	3	3qt0_486_A_4 PDB CREDO	0.524	0.281	0.507	0.010
Rv1248c.2	2	3mno_DEX_A_784 PDB CREDO	0.860	0.008	0.507	0.010
Rv1248c.2	2	2ity_IRE_A_2020 PDB CREDO	0.527	0.277	0.507	0.010
Rv1248c.1	11	1d4y_TPV_A_501 PDB CREDO	0.538	0.261	0.507	0.010
Rv1248c.2	2	2ab2_SNL_A_502 PDB CREDO	0.833	0.014	0.506	0.010
Rv1248c.1	2	3hbb_TMQ_A_611 PDB CREDO	0.530	0.272	0.506	0.010
Rv1248c.1	4	1s9p_DES_C_500 PDB CREDO	0.634	0.141	0.506	0.010
Rv1248c.4	3	2a68_RBT_C_8001 PDB CREDO	0.582	0.201	0.506	0.010
Rv1248c.1	11	3hec_STI_A_1 PDB CREDO	0.572	0.214	0.506	0.010
Rv1248c.2	2	2bdm_TMI_A_502 PDB CREDO	0.756	0.044	0.506	0.010
Rv1248c.2	2	2bxf_DZP_A_2001 PDB CREDO	0.655	0.119	0.506	0.010
Rv1248c.1	11	1xzx_T3_X_500 PDB CREDO	0.590	0.191	0.506	0.010
Rv1248c.1	11	3tkd_CYZ_B_267 PDB CREDO	0.537	0.262	0.506	0.010
Rv1248c.2	2	1eqg_IBP_A_701 PDB CREDO	0.654	0.120	0.505	0.010
Rv1248c.2	2	1kvl_CLS_A_371 PDB CREDO	0.625	0.150	0.505	0.010
Rv1248c.2	2	2jap_J01_D_1249 PDB CREDO	0.719	0.067	0.505	0.010
Rv1248c.2	2	3mnp_DEX_A_784 PDB CREDO	0.858	0.009	0.505	0.010
Rv1248c.1	2	2ij7_TPF_D_2473 PDB CREDO	0.555	0.237	0.505	0.010
Rv1248c.1	11	2aoj_FRD_C_305 PDB CREDO	0.520	0.287	0.505	0.010
Rv1248c.1	2	2pkm_ADN_A_501 PDB CREDO	0.529	0.275	0.505	0.010
Rv1248c.4	3	1d4f_ADN_C_603 PDB CREDO	0.560	0.231	0.505	0.010
Rv1248c.2	2	2iyf_ERY_A_1400 PDB CREDO	0.504	0.311	0.504	0.010
Rv1248c.4	3	3uvv_T3_A_501 PDB CREDO	0.556	0.235	0.504	0.010
Rv1248c.1	2	1iol_EST_A_400 PDB CREDO	0.528	0.275	0.504	0.010
Rv1248c.1	2	2ij7_TPF_A_2472 PDB CREDO	0.554	0.238	0.504	0.010
Rv1248c.1	2	3f8w_ADN_C_302 PDB CREDO	0.504	0.312	0.504	0.010
Rv1248c.3	2	2xn7_T44_A_1355 PDB CREDO	0.504	0.313	0.504	0.010
Rv1248c.1	2	2ij7_TPF_B_2470 PDB CREDO	0.553	0.240	0.503	0.010
Rv1248c.1	11	2hyy_STI_B_600 PDB CREDO	0.518	0.290	0.503	0.010
Rv1248c.1	2	1kvl_CLS_A_371 PDB CREDO	0.526	0.278	0.503	0.010
Rv1248c.1	11	2o4p_TPV_A_300 PDB CREDO	0.518	0.291	0.503	0.010
Rv1248c.2	2	2jap_J01_C_1249 PDB CREDO	0.715	0.069	0.503	0.010
Rv1248c.1	11	3cs9_NIL_B_600 PDB CREDO	0.596	0.184	0.503	0.010
Rv1248c.2	2	2oax_SNL_C_3001 PDB CREDO	0.826	0.016	0.502	0.011
Rv1248c.1	11	2ab2_SNL_B_503 PDB CREDO	0.567	0.221	0.502	0.011
Rv1248c.2	2	1fdu_EST_C_353 PDB CREDO	0.543	0.254	0.502	0.011
Rv1248c.2	2	2ydo_ADN_A_400 PDB CREDO	0.593	0.187	0.501	0.011
Rv1248c.1	2	3g0f_B49_A_9001 PDB CREDO	0.501	0.317	0.501	0.011
Rv1248c.2	2	2oax_SNL_B_2001 PDB CREDO	0.824	0.017	0.501	0.011
Rv1248c.1	11	1z2b_VLB_C_800 PDB CREDO	0.516	0.294	0.501	0.011
Rv1248c.1	11	2y6o_1N1_A_1892 PDB CREDO	0.584	0.198	0.501	0.011
Rv1248c.1	11	3oez_STI_B_601 PDB CREDO	0.566	0.222	0.501	0.011
Rv1248c.1	11	2f80_017_B_301 PDB CREDO	0.712	0.072	0.501	0.011
Rv1248c.1	11	2ab2_SNL_A_502 PDB CREDO	0.565	0.223	0.500	0.011
Rv1248c.2	2	1fj8_CER_A_500 PDB CREDO	0.543	0.253	0.500	0.011

Similarity to known drug target from sensitive sequence analysis

No drug targets

List of small molecules tested from TIBLE

Data not available

Off-target activity - ligand based from TIBLE

Data not available

Small molecules involved in protein-protein complex from TIMBAL .Proteins similar to Mtb based on sequence analysis.

Data not available

STITCH interactions

Chemical Name	Confidence score	Molecular Weight
alpha-ketoglutaratePubChem	0.992	146.098
succinyl-CoAPubChem	0.973	867.607
coenzyme APubChem	0.97	767.534
glutamatePubChem	0.964	147.129
ammoniaPubChem	0.956	17.0305
NADPPubChem	0.954	744.413
carbon dioxidePubChem	0.937	44.0095
Co-APubChem	0.9	767.534
deuteriumPubChem	0.9	2.01588
NADP(H)PubChem	0.9	745.421
hydroxyl radicalsPubChem	0.9	17.0073
suc-coaPubChem	0.9	867.607
protiumPubChem	0.9	2.01576
H(+)PubChem	0.9	2.01588
glyoxylatePubChem	0.868	74.0355
4-(2'-carboxyphenyl)-4-oxobutyric acidPubChem	0.847	222.194
succinatePubChem	0.837	118.088
succinic semialdehydePubChem	0.791	102.089
vitamin K2PubChem	0.743	308.414
dihydrolipoamidePubChem	0.739	207.357
isocitratePubChem	0.739	192.124