SInCRe - Rv3303c

Tuberculist information

Gene name	lpdA
Protein function	NAD(P)H quinone reductase LpdA
Functional category(tuberculist)	intermediary metabolism and respiration
Gene location(kb)	3689.46
Molecular mass(da)	51456.9
External sites	TB Database TubercuList WebTB

Protein sequence

Number of amino acids : 493

	  		  	1    VVTRIVILGGGPAGYEAALVAATSHPETTQVTVIDCDGIGGAAVLDDCVPSKTFIASTGL   60
			  	61   RTELRRAPHLGFHIDFDDAKISLPQIHARVKTLAAAQSADITAQLLSMGVQVIAGRGELI  120
			  	121  DSTPGLARHRIKATAADGSTSEHEADVVLVATGASPRILPSAQPDGERILTWRQLYDLDA  180
			  	181  LPDHLIVVGSGVTGAEFVDAYTELGVPVTVVASQDHVLPYEDADAALVLEESFAERGVRL  240
			  	241  FKNARAASVTRTGAGVLVTMTDGRTVEGSHALMTIGSVPNTSGLGLERVGIQLGRGNYLT  300
			  	301  VDRVSRTLATGIYAAGDCTGLLPLASVAAMQGRIAMYHALGEGVSPIRLRTVAATVFTRP  360
			  	361  EIAAVGVPQSVIDAGSVAARTIMLPLRTNARAKMSEMRHGFVKIFCRRSTGVVIGGVVVA  420
			  	421  PIASELILPIAVAVQNRITVNELAQTLAVYPSLSGSITEAARRLMAHDDLDCTAAQDAAE  480
			  	481  QLALVPHHLPTSN

Known structures in the PDB

	PDB ID	1XDI
	Total residue count	998
	Number of chains	2
	Method	X-RAY
	Resolution	2.81

Number of amino acids : 493

Domains assigned based on sequence.

Mtb Structural proteome models

CHOPIN models

Profile-based domain assignment

Structural/Functional domain family	Pfam acc.no./SCOP ID	Domain Region
Pyr_redox_2	PF07992	4-322
Pyr_redox	PF00070	184-264
Pyr_redox_dim	PF02852	352-461

Mtb Structural Proteome models

Model Number	1
Model name	Rv3303c_1xdi_A
Template	1XDI APDB CREDO
Template coverage	2_466
Template Identity(%)	100.0
Model coverage(%)	94.1
Normalized DOPE score	-0.827

Model Number	2
Model name	Rv3303c
Template	1XDI APDB CREDO
Template coverage	2_466
Template Identity(%)	100.0
Model coverage(%)	94.1
Normalized DOPE score	-0.629

Structure Models from Chopin

Model Number	1
Profile	c.3.1.5, d.87.1.1 Click for model details
zscore	67.03
Residue begin	1
Residue end	493

Model Number	2
Profile	c.3.1.5 Click for model details
zscore	13.99
Residue begin	146
Residue end	307

Model Number	3
Profile	d.87.1.1 Click for model details
zscore	12.56
Residue begin	352
Residue end	461

Model Number	4
Profile	d.87.1.1 Click for model details
zscore	10.66
Residue begin	292
Residue end	482

Binding pockets

STRING

Cytoscape Web will replace the contents of this div with protein-protein interaction network.

Protein interacting with Rv3303c	Gene name	Confidence Score
Rv2215	dlaT	0.987
Rv2215	dlaT	0.987
Rv2215	dlaT	0.987
Rv2496c	bkdB	0.986
Rv2496c	bkdB	0.986
Rv2495c	bkdC	0.985
Rv2495c	bkdC	0.985
Rv2495c	bkdC	0.985
Rv2497c	bkdA	0.976
Rv0843	Rv0843	0.946
Rv1832	gcvB	0.935
Rv1832	gcvB	0.935
Rv2241	aceE	0.931
Rv2211c	gcvT	0.922
Rv2211c	gcvT	0.922

Potential ligand/drug binding sites

Protein Model	Pocket Number	Drug Binding Site	PMIN Score	Pvalue PMIN	PMAX Score	Pvalue PMAX
Rv3303c_1xdi_A	3	1c6y_MK1_B_524 PDB CREDO	0.704	0.078	0.686	0.000
Rv3303c_1xdi_A	3	1n49_RIT_B_301 PDB CREDO	0.711	0.073	0.655	0.001
Rv3303c_1xdi_A	3	3ekq_ROC_A_100 PDB CREDO	0.679	0.098	0.643	0.001
Rv3303c_1xdi_A	3	2q64_1UN_B_1001 PDB CREDO	0.725	0.063	0.638	0.001
Rv3303c_1xdi_A	3	3el9_DR7_A_100 PDB CREDO	0.654	0.121	0.636	0.001
Rv3303c_1xdi_A	3	2qak_1UN_A_1001 PDB CREDO	0.724	0.064	0.636	0.001
Rv3303c_1xdi_A	3	2pyn_1UN_A_1001 PDB CREDO	0.722	0.065	0.635	0.001
Rv3303c_1xdi_A	3	1c6z_ROC_B_505 PDB CREDO	0.722	0.065	0.635	0.001
Rv3303c_1xdi_A	3	2pym_1UN_A_1001 PDB CREDO	0.721	0.066	0.634	0.001
Rv3303c_1xdi_A	3	2q63_1UN_A_1001 PDB CREDO	0.719	0.067	0.632	0.001
Rv3303c_1xdi_A	3	3ggu_017_B_201 PDB CREDO	0.658	0.117	0.624	0.001
Rv3303c_1xdi_A	3	3ufn_ROC_A_401 PDB CREDO	0.638	0.136	0.622	0.001
Rv3303c_1xdi_A	3	1n49_RIT_D_401 PDB CREDO	0.733	0.058	0.621	0.001
Rv3303c_1xdi_A	3	3spk_TPV_B_100 PDB CREDO	0.752	0.047	0.619	0.001
Rv3303c_1xdi_A	6	3tne_RIT_A_401 PDB CREDO	0.652	0.122	0.612	0.002
Rv3303c_1xdi_A	3	3lzv_017_A_200 PDB CREDO	0.678	0.099	0.608	0.002
Rv3303c_1xdi_A	3	1rl8_RIT_A_9001 PDB CREDO	0.708	0.075	0.607	0.002
Rv3303c_1xdi_A	3	1hsh_MK1_A_401 PDB CREDO	0.623	0.152	0.607	0.002
Rv3303c_1xdi_A	3	1hsh_MK1_C_402 PDB CREDO	0.623	0.153	0.606	0.002
Rv3303c_1xdi_A	3	3el0_1UN_A_201 PDB CREDO	0.676	0.100	0.606	0.002
Rv3303c_1xdi_A	6	1lhv_NOG_A_301 PDB CREDO	0.623	0.152	0.604	0.002
Rv3303c_1xdi_A	3	1sh9_RIT_B_301 PDB CREDO	0.616	0.160	0.600	0.002
Rv3303c_1xdi_A	3	3ogq_AB1_A_200 PDB CREDO	0.648	0.127	0.599	0.002
Rv3303c_1xdi_A	3	3el5_1UN_B_201 PDB CREDO	0.661	0.114	0.596	0.002
Rv3303c_1xdi_A	3	1k6c_MK1_B_902 PDB CREDO	0.745	0.051	0.595	0.002
Rv3303c_1xdi_A	3	1t7i_017_A_200 PDB CREDO	0.744	0.051	0.594	0.002
Rv3303c_1xdi_A	3	1ohr_1UN_A_201 PDB CREDO	0.610	0.167	0.594	0.002
Rv3303c_1xdi_A	3	3so9_017_A_100 PDB CREDO	0.788	0.029	0.593	0.002
Rv3303c_1xdi_A	3	1hxw_RIT_B_301 PDB CREDO	0.624	0.152	0.592	0.002
Rv3303c_1xdi_A	3	1t7j_478_A_200 PDB CREDO	0.783	0.031	0.589	0.003
Rv3303c_1xdi_A	3	3el4_ROC_A_100 PDB CREDO	0.738	0.055	0.589	0.003
Rv3303c_1xdi_A	3	1hxb_ROC_A_100 PDB CREDO	0.670	0.106	0.589	0.003
Rv3303c_1xdi_A	3	2f80_017_B_301 PDB CREDO	0.670	0.106	0.589	0.003
Rv3303c_1xdi_A	3	3sm2_478_A_126 PDB CREDO	0.651	0.124	0.587	0.003
Rv3303c_1xdi_A	6	3tne_RIT_B_401 PDB CREDO	0.624	0.151	0.585	0.003
Rv3303c_1xdi_A	3	1xkk_FMM_A_91 PDB CREDO	0.616	0.160	0.585	0.003
Rv3303c_1xdi_A	3	3s56_ROC_A_201 PDB CREDO	0.595	0.186	0.579	0.003
Rv3303c_1xdi_A	3	1t46_STI_A_3 PDB CREDO	0.579	0.206	0.579	0.003
Rv3303c_1xdi_A	3	1sgu_MK1_B_2632 PDB CREDO	0.680	0.097	0.576	0.003
Rv3303c_1xdi_A	3	2fxd_DR7_A_102 PDB CREDO	0.589	0.193	0.573	0.003
Rv3303c_1xdi_A	3	3pwr_ROC_A_401 PDB CREDO	0.683	0.095	0.572	0.003
Rv3303c_1xdi_A	3	3gp0_NIL_A_1 PDB CREDO	0.585	0.198	0.569	0.004
Rv3303c_1xdi_A	6	3tkd_CYZ_A_266 PDB CREDO	0.604	0.174	0.567	0.004
Rv3303c_1xdi_A	3	2r5q_1UN_B_900 PDB CREDO	0.687	0.091	0.566	0.004
Rv3303c_1xdi_A	3	2r5q_1UN_D_900 PDB CREDO	0.687	0.091	0.565	0.004
Rv3303c_1xdi_A	3	3ekx_1UN_B_201 PDB CREDO	0.611	0.167	0.565	0.004
Rv3303c_1xdi_A	3	3ogp_017_B_200 PDB CREDO	0.665	0.110	0.564	0.004
Rv3303c_1xdi_A	3	2nnp_ROC_A_401 PDB CREDO	0.704	0.078	0.562	0.004
Rv3303c_1xdi_A	6	3d91_REM_B_350 PDB CREDO	0.675	0.101	0.561	0.004
Rv3303c_1xdi_A	6	3d91_REM_A_350 PDB CREDO	0.673	0.103	0.558	0.004
Rv3303c_1xdi_A	6	1uwh_BAX_A_1723 PDB CREDO	0.630	0.145	0.556	0.005
Rv3303c_1xdi_A	6	1uwh_BAX_B_1723 PDB CREDO	0.630	0.145	0.555	0.005
Rv3303c_1xdi_A	6	3tkd_CYZ_B_267 PDB CREDO	0.627	0.149	0.552	0.005
Rv3303c_1xdi_A	6	1z2b_VLB_C_800 PDB CREDO	0.646	0.129	0.552	0.005
Rv3303c_1xdi_A	3	2nnk_ROC_A_401 PDB CREDO	0.675	0.101	0.552	0.005
Rv3303c_1xdi_A	3	3bvb_017_B_401 PDB CREDO	0.657	0.117	0.550	0.005
Rv3303c_1xdi_A	3	1hsg_MK1_B_902 PDB CREDO	0.565	0.223	0.550	0.005
Rv3303c_1xdi_A	3	3ndt_ROC_D_100 PDB CREDO	0.670	0.105	0.548	0.005
Rv3303c_1xdi_A	3	2bpx_MK1_B_902 PDB CREDO	0.610	0.167	0.547	0.005
Rv3303c_1xdi_A	3	3t3c_017_A_201 PDB CREDO	0.576	0.209	0.546	0.005
Rv3303c_1xdi_A	3	3nu6_478_B_401 PDB CREDO	0.575	0.210	0.545	0.005
Rv3303c_1xdi_A	3	1sdv_MK1_B_902 PDB CREDO	0.544	0.252	0.544	0.005
Rv3303c_1xdi_A	3	3ogp_017_A_200 PDB CREDO	0.701	0.080	0.544	0.005
Rv3303c_1xdi_A	3	3oxv_478_C_200 PDB CREDO	0.543	0.254	0.543	0.006
Rv3303c_1xdi_A	3	3pww_ROC_A_1001 PDB CREDO	0.542	0.255	0.542	0.006
Rv3303c_1xdi_A	6	2x9g_LYA_A_1270 PDB CREDO	0.558	0.232	0.541	0.006
Rv3303c_1xdi_A	3	3nu4_478_B_401 PDB CREDO	0.541	0.257	0.541	0.006
Rv3303c_1xdi_A	3	4dqb_017_B_101 PDB CREDO	0.540	0.258	0.540	0.006
Rv3303c_1xdi_A	6	1uwj_BAX_B_1723 PDB CREDO	0.648	0.126	0.538	0.006
Rv3303c_1xdi_A	3	2qhc_AB1_B_9001 PDB CREDO	0.617	0.159	0.538	0.006
Rv3303c_1xdi_A	3	3em4_DR7_A_100 PDB CREDO	0.552	0.242	0.537	0.006
Rv3303c_1xdi_A	6	2x9g_LYA_B_1270 PDB CREDO	0.573	0.213	0.536	0.006
Rv3303c_1xdi_A	3	4dqc_017_A_101 PDB CREDO	0.565	0.223	0.536	0.006
Rv3303c_1xdi_A	3	3ucb_017_A_201 PDB CREDO	0.655	0.119	0.536	0.006
Rv3303c_1xdi_A	3	3s53_017_A_201 PDB CREDO	0.580	0.204	0.534	0.006
Rv3303c_1xdi_A	3	3nu9_478_A_401 PDB CREDO	0.594	0.187	0.532	0.007
Rv3303c_1xdi_A	3	3oxw_017_B_200 PDB CREDO	0.577	0.208	0.532	0.007
Rv3303c_1xdi_A	3	2b60_RIT_B_100 PDB CREDO	0.546	0.250	0.532	0.007
Rv3303c_1xdi_A	3	2b7z_MK1_B_200 PDB CREDO	0.627	0.148	0.532	0.007
Rv3303c_1xdi_A	3	4dqh_017_B_101 PDB CREDO	0.576	0.208	0.532	0.007
Rv3303c_1xdi_A	6	2y6o_1N1_A_1892 PDB CREDO	0.549	0.245	0.531	0.007
Rv3303c_1xdi_A	3	2q5k_AB1_A_201 PDB CREDO	0.561	0.229	0.531	0.007
Rv3303c_1xdi_A	6	1lhu_EST_A_301 PDB CREDO	0.628	0.147	0.530	0.007
Rv3303c_1xdi_A	3	1sa1_POD_B_700 PDB CREDO	0.663	0.112	0.530	0.007
Rv3303c_1xdi_A	6	1uwj_BAX_A_1723 PDB CREDO	0.696	0.084	0.530	0.007
Rv3303c_1xdi_A	6	1p93_DEX_D_4999 PDB CREDO	0.530	0.273	0.530	0.007
Rv3303c_1xdi_A	3	3oxw_017_D_200 PDB CREDO	0.575	0.211	0.530	0.007
Rv3303c_1xdi_A	3	3k4v_ROC_D_201 PDB CREDO	0.679	0.098	0.529	0.007
Rv3303c_1xdi_A	6	2aa5_STR_A_301 PDB CREDO	0.546	0.249	0.529	0.007
Rv3303c_1xdi_A	6	2aa5_STR_B_302 PDB CREDO	0.546	0.249	0.529	0.007
Rv3303c_1xdi_A	3	3em6_017_A_200 PDB CREDO	0.590	0.192	0.529	0.007
Rv3303c_1xdi_A	3	3nuo_478_B_478 PDB CREDO	0.543	0.254	0.529	0.007
Rv3303c_1xdi_A	6	1cil_ETS_A_263 PDB CREDO	0.583	0.200	0.528	0.007
Rv3303c_1xdi_A	6	2fum_MIX_D_3539 PDB CREDO	0.582	0.202	0.526	0.007
Rv3303c_1xdi_A	6	2aax_PDN_A_502 PDB CREDO	0.543	0.254	0.526	0.007
Rv3303c_1xdi_A	3	1hpv_478_B_200 PDB CREDO	0.585	0.198	0.525	0.007
Rv3303c_1xdi_A	3	3ttp_017_A_201 PDB CREDO	0.585	0.198	0.524	0.008
Rv3303c_1xdi_A	3	4dqe_017_B_101 PDB CREDO	0.601	0.178	0.524	0.008
Rv3303c_1xdi_A	3	3tkg_ROC_C_901 PDB CREDO	0.688	0.090	0.524	0.008
Rv3303c_1xdi_A	6	3mne_DEX_A_784 PDB CREDO	0.524	0.281	0.524	0.008
Rv3303c_1xdi_A	3	3lzs_017_A_200 PDB CREDO	0.584	0.199	0.524	0.008
Rv3303c_1xdi_A	6	3q70_RIT_A_2001 PDB CREDO	0.612	0.165	0.523	0.008
Rv3303c_1xdi_A	3	1sa1_POD_D_701 PDB CREDO	0.674	0.102	0.523	0.008
Rv3303c_1xdi_A	6	2aax_PDN_B_503 PDB CREDO	0.540	0.258	0.523	0.008
Rv3303c_1xdi_A	3	3eky_DR7_A_100 PDB CREDO	0.551	0.243	0.523	0.008
Rv3303c_1xdi_A	3	3d1y_ROC_A_201 PDB CREDO	0.609	0.168	0.523	0.008
Rv3303c_1xdi_A	6	3gn8_DEX_B_247 PDB CREDO	0.522	0.284	0.522	0.008
Rv3303c_1xdi_A	6	1m2z_DEX_A_301 PDB CREDO	0.522	0.285	0.522	0.008
Rv3303c_1xdi_A	6	1p93_DEX_C_3999 PDB CREDO	0.521	0.285	0.521	0.008
Rv3303c_1xdi_A	6	3gn8_DEX_A_247 PDB CREDO	0.521	0.285	0.521	0.008
Rv3303c_1xdi_A	3	2qxs_RAL_A_600 PDB CREDO	0.550	0.244	0.521	0.008
Rv3303c_1xdi_A	6	2aa6_STR_B_402 PDB CREDO	0.538	0.261	0.521	0.008
Rv3303c_1xdi_A	6	2aa6_STR_A_401 PDB CREDO	0.538	0.261	0.520	0.008
Rv3303c_1xdi_A	3	2qxs_RAL_B_600 PDB CREDO	0.549	0.245	0.520	0.008
Rv3303c_1xdi_A	3	3n3i_ROC_A_201 PDB CREDO	0.564	0.225	0.520	0.008
Rv3303c_1xdi_A	3	2r5p_MK1_B_902 PDB CREDO	0.547	0.248	0.519	0.008
Rv3303c_1xdi_A	6	1m2z_DEX_D_401 PDB CREDO	0.519	0.289	0.519	0.008
Rv3303c_1xdi_A	6	3jwq_VIA_D_901 PDB CREDO	0.573	0.212	0.519	0.008
Rv3303c_1xdi_A	3	3ebz_017_B_201 PDB CREDO	0.630	0.145	0.519	0.008
Rv3303c_1xdi_A	3	2fxe_DR7_A_102 PDB CREDO	0.546	0.249	0.518	0.008
Rv3303c_1xdi_A	3	2r5p_MK1_D_902 PDB CREDO	0.546	0.250	0.518	0.008
Rv3303c_1xdi_A	3	2z54_AB1_A_200 PDB CREDO	0.629	0.146	0.518	0.008
Rv3303c_1xdi_A	6	1hwi_115_A_2 PDB CREDO	0.535	0.265	0.518	0.008
Rv3303c_1xdi_A	6	3nrr_D16_B_520 PDB CREDO	0.592	0.189	0.517	0.008
Rv3303c_1xdi_A	3	3el1_DR7_A_100 PDB CREDO	0.559	0.232	0.517	0.008
Rv3303c_1xdi_A	3	3oy4_017_B_200 PDB CREDO	0.627	0.148	0.516	0.008
Rv3303c_1xdi_A	3	1sdu_MK1_B_902 PDB CREDO	0.558	0.233	0.516	0.009
Rv3303c_1xdi_A	6	2gqg_1N1_B_502 PDB CREDO	0.533	0.269	0.516	0.009
Rv3303c_1xdi_A	6	3spk_TPV_A_100 PDB CREDO	0.551	0.243	0.516	0.009
Rv3303c_1xdi_A	3	3ekw_DR7_B_100 PDB CREDO	0.556	0.235	0.515	0.009
Rv3303c_1xdi_A	3	3em4_DR7_V_100 PDB CREDO	0.542	0.255	0.514	0.009
Rv3303c_1xdi_A	3	2o4p_TPV_A_300 PDB CREDO	0.624	0.151	0.514	0.009
Rv3303c_1xdi_A	3	3cyx_ROC_A_201 PDB CREDO	0.690	0.089	0.514	0.009
Rv3303c_1xdi_A	3	2aof_FRD_C_305 PDB CREDO	0.659	0.116	0.514	0.009
Rv3303c_1xdi_A	6	1p93_DEX_B_2999 PDB CREDO	0.568	0.220	0.513	0.009
Rv3303c_1xdi_A	6	3oct_1N1_A_663 PDB CREDO	0.587	0.194	0.513	0.009
Rv3303c_1xdi_A	6	1fm6_BRL_X_504 PDB CREDO	0.530	0.273	0.513	0.009
Rv3303c_1xdi_A	6	3frq_ERY_B_195 PDB CREDO	0.547	0.248	0.513	0.009
Rv3303c_1xdi_A	6	4eyb_0WO_A_303 PDB CREDO	0.607	0.171	0.512	0.009
Rv3303c_1xdi_A	3	2rkf_AB1_A_501 PDB CREDO	0.539	0.259	0.512	0.009
Rv3303c_1xdi_A	3	3ndu_ROC_D_100 PDB CREDO	0.686	0.092	0.511	0.009
Rv3303c_1xdi_A	6	2x9g_LYA_C_1270 PDB CREDO	0.584	0.198	0.511	0.009
Rv3303c_1xdi_A	6	3bbt_FMM_D_91 PDB CREDO	0.565	0.224	0.511	0.009
Rv3303c_1xdi_A	6	1p93_DEX_A_1999 PDB CREDO	0.564	0.225	0.510	0.009
Rv3303c_1xdi_A	6	1zgy_BRL_A_503 PDB CREDO	0.545	0.252	0.510	0.009
Rv3303c_1xdi_A	6	2h42_VIA_A_901 PDB CREDO	0.560	0.230	0.507	0.010
Rv3303c_1xdi_A	3	3em3_478_B_200 PDB CREDO	0.548	0.247	0.507	0.010
Rv3303c_1xdi_A	6	2x9g_LYA_D_1270 PDB CREDO	0.580	0.204	0.507	0.010
Rv3303c_1xdi_A	3	3q70_RIT_A_2001 PDB CREDO	0.652	0.123	0.506	0.010
Rv3303c_1xdi_A	3	2o4n_TPV_A_300 PDB CREDO	0.671	0.104	0.505	0.010
Rv3303c_1xdi_A	6	2ab2_SNL_B_503 PDB CREDO	0.538	0.261	0.504	0.010
Rv3303c_1xdi_A	3	4dqf_017_B_101 PDB CREDO	0.545	0.251	0.504	0.010
Rv3303c_1xdi_A	6	2ab2_SNL_A_502 PDB CREDO	0.537	0.262	0.504	0.010
Rv3303c_1xdi_A	6	3apw_DP0_A_190 PDB CREDO	0.520	0.288	0.503	0.010
Rv3303c_1xdi_A	3	2aoi_FRD_C_305 PDB CREDO	0.572	0.215	0.503	0.010
Rv3303c_1xdi_A	3	3prs_RIT_A_1001 PDB CREDO	0.586	0.197	0.503	0.010
Rv3303c_1xdi_A	3	3ekv_478_A_200 PDB CREDO	0.543	0.254	0.502	0.011
Rv3303c_1xdi_A	6	2oax_SNL_C_3001 PDB CREDO	0.535	0.265	0.502	0.011
Rv3303c_1xdi_A	6	3k54_1N1_A_1 PDB CREDO	0.639	0.135	0.502	0.011
Rv3303c_1xdi_A	6	1uob_PNN_A_1311 PDB CREDO	0.586	0.196	0.502	0.011
Rv3303c_1xdi_A	6	2nni_MTK_A_501 PDB CREDO	0.622	0.154	0.501	0.011
Rv3303c_1xdi_A	6	3ln1_CEL_B_682 PDB CREDO	0.501	0.317	0.501	0.011
Rv3303c_1xdi_A	6	1hwi_115_D_3 PDB CREDO	0.534	0.267	0.500	0.011

Similarity to known drug target from sensitive sequence analysis

No drug targets

List of small molecules tested from TIBLE

Data not available

Off-target activity - ligand based from TIBLE

Data not available

Small molecules involved in protein-protein complex from TIMBAL .Proteins similar to Mtb based on sequence analysis.

Data not available

STITCH interactions

Chemical Name	Confidence score	Molecular Weight
flavin adenine dinucleotidePubChem	0.989	785.55
lipoamidePubChem	0.96	205.341
NAD+PubChem	0.944	663.425
H(+)PubChem	0.927	2.01588
deuteriumPubChem	0.925	2.01588
dihydrolipoamidePubChem	0.916	207.357
reduced nicotinamide adenine dinucleotidePubChem	0.907	665.441
acetyl-CoAPubChem	0.905	809.571
coenzyme APubChem	0.901	767.534
protiumPubChem	0.9	2.01576
pyruvic acidPubChem	0.9	88.0621
acetyl coenzyme-APubChem	0.9	809.571
dihydronicotinamide formycin dinucleotidePubChem	0.9	665.441
LPMPubChem	0.9	207.357
DL-lipoamidePubChem	0.9	205.341
carbon dioxidePubChem	0.9	44.0095
Co-APubChem	0.9	767.534