SInCRe - Rv2584c

Tuberculist information

Gene name	apt
Protein function	Adenine phosphoribosyltransferase Apt (APRT) (AMP diphosphorylase) (AMP pyrophosphorylase) (transphosphoribosidase)
Functional category(tuberculist)	intermediary metabolism and respiration
Gene location(kb)	2910.23
Molecular mass(da)	23155.7
External sites	TB Database TubercuList WebTB

Protein sequence

Number of amino acids : 223

	  		  	1    VCHGGTWAGDYVLNVIATGLSLKARGKRRRQRWVDDGRVLALGESRRSSAISVADVVASL   60
			  	61   TRDVADFPVPGVEFKDLTPLFADRRGLAAVTEALADRASGADLVAGVDARGFLVAAAVAT  120
			  	121  RLEVGVLAVRKGGKLPRPVLSEEYYRAYGAATLEILAEGIEVAGRRVVIIDDVLATGGTI  180
			  	181  GATRRLLERGGANVAGAAVVVELAGLSGRAALAPLPVHSLSRL

Known structures in the PDB

No Known structures

Number of amino acids : 223

Domains assigned based on sequence.

Mtb Structural proteome models

CHOPIN models

Profile-based domain assignment

Structural/Functional domain family	Pfam acc.no./SCOP ID	Domain Region
Pribosyltran	PF00156	79-201

Mtb Structural Proteome models

Model Number	1
Model name	Rv2584c
Template	1ZN8 APDB CREDO
Template coverage	6_179
Template Identity(%)	41.8
Model coverage(%)	75.8
Normalized DOPE score	-0.127

Model Number	2
Model name	Rv2584c.1
Template	1O57 APDB CREDO
Template coverage	39_255
Template Identity(%)	25.0
Model coverage(%)	96.4
Normalized DOPE score	0.754

Structure Models from Chopin

Model Number	1
Profile	c.61.1.1 - 3.40.50.2020 Click for model details
zscore	12.13
Residue begin	1
Residue end	223

Binding pockets

STRING

Cytoscape Web will replace the contents of this div with protein-protein interaction network.

Protein interacting with Rv2584c	Gene name	Confidence Score
Rv1389	gmk	0.996
Rv0777	purB	0.994
Rv0777	purB	0.994
Rv3396c	guaA	0.992
Rv3396c	guaA	0.992
Rv3396c	guaA	0.992
Rv0957	purH	0.99
Rv0957	purH	0.99
Rv0733	adk	0.988
Rv2583c	relA	0.986
Rv2583c	relA	0.986
Rv2583c	relA	0.986
Rv2583c	relA	0.986
Rv3624c	hpt	0.985
Rv3309c	upp	0.975
Rv3307	deoD	0.974
Rv2202c	adoK	0.97
Rv3393	iunH	0.956
Rv3314c	deoA	0.954
Rv3314c	deoA	0.954
Rv3314c	deoA	0.954
Rv1438	tpi	0.951
Rv1017c	prsA	0.949
Rv1017c	prsA	0.949
Rv1699	pyrG	0.944
Rv1699	pyrG	0.944
Rv3834c	serS	0.931
Rv3834c	serS	0.931
Rv1602	hisH	0.929
Rv2534c	efp	0.923
Rv2534c	efp	0.923
Rv2534c	efp	0.923
Rv2540c	aroF	0.91
Rv0357c	purA	0.903

Potential ligand/drug binding sites

Protein Model	Pocket Number	Drug Binding Site	PMIN Score	Pvalue PMIN	PMAX Score	Pvalue PMAX
Rv2584c.1	2	3erd_DES_B_800 PDB CREDO	0.743	0.052	0.717	0.000
Rv2584c.1	2	1s9p_DES_A_459 PDB CREDO	0.711	0.072	0.711	0.000
Rv2584c.1	2	1s9p_DES_D_600 PDB CREDO	0.701	0.080	0.701	0.000
Rv2584c.1	2	3erd_DES_A_600 PDB CREDO	0.723	0.064	0.698	0.000
Rv2584c.1	2	1mx1_THA_C_3 PDB CREDO	0.684	0.094	0.684	0.000
Rv2584c.1	2	1mx1_THA_E_5 PDB CREDO	0.716	0.069	0.666	0.001
Rv2584c.1	2	3bbt_FMM_D_91 PDB CREDO	0.704	0.077	0.657	0.001
Rv2584c.1	2	1ya4_CTX_C_3 PDB CREDO	0.809	0.022	0.646	0.001
Rv2584c.1	2	1ya4_CTX_B_2 PDB CREDO	0.807	0.022	0.645	0.001
Rv2584c.1	2	3oht_1N1_B_1000 PDB CREDO	0.645	0.130	0.645	0.001
Rv2584c.1	2	2j7y_E3O_A_1454 PDB CREDO	0.735	0.057	0.635	0.001
Rv2584c.1	2	3ols_EST_A_600 PDB CREDO	0.807	0.022	0.619	0.001
Rv2584c.1	2	3ols_EST_B_600 PDB CREDO	0.807	0.022	0.619	0.001
Rv2584c.1	2	1g50_EST_A_600 PDB CREDO	0.804	0.023	0.617	0.002
Rv2584c.1	2	3uud_EST_A_600 PDB CREDO	0.804	0.023	0.617	0.002
Rv2584c.1	2	2yja_EST_B_1550 PDB CREDO	0.802	0.024	0.615	0.002
Rv2584c.1	2	3uud_EST_B_600 PDB CREDO	0.802	0.024	0.615	0.002
Rv2584c.1	2	3spk_TPV_A_100 PDB CREDO	0.679	0.098	0.612	0.002
Rv2584c.1	2	1qkn_RAL_A_600 PDB CREDO	0.724	0.064	0.611	0.002
Rv2584c.1	2	3bbt_FMM_B_91 PDB CREDO	0.703	0.078	0.607	0.002
Rv2584c.1	2	2fum_MIX_D_3539 PDB CREDO	0.637	0.137	0.594	0.002
Rv2584c.1	2	1err_RAL_B_600 PDB CREDO	0.773	0.036	0.593	0.002
Rv2584c.1	2	1err_RAL_A_600 PDB CREDO	0.772	0.036	0.592	0.002
Rv2584c.1	2	2jfa_RAL_A_600 PDB CREDO	0.748	0.049	0.592	0.002
Rv2584c.1	2	2jfa_RAL_B_600 PDB CREDO	0.769	0.038	0.590	0.003
Rv2584c.1	2	1mx1_THA_D_4 PDB CREDO	0.737	0.055	0.589	0.003
Rv2584c.1	2	1mx1_THA_F_6 PDB CREDO	0.737	0.055	0.589	0.003
Rv2584c.1	2	3h0a_9RA_A_500 PDB CREDO	0.630	0.145	0.587	0.003
Rv2584c.1	1	1uwj_BAX_A_1723 PDB CREDO	0.621	0.154	0.587	0.003
Rv2584c.1	2	1jg2_ADN_A_500 PDB CREDO	0.607	0.171	0.586	0.003
Rv2584c.1	2	1sqn_NDR_A_1001 PDB CREDO	0.586	0.196	0.586	0.003
Rv2584c.1	2	1s9p_DES_C_500 PDB CREDO	0.732	0.059	0.585	0.003
Rv2584c.1	2	1sqn_NDR_B_2001 PDB CREDO	0.583	0.200	0.583	0.003
Rv2584c.1	2	1s9p_DES_B_459 PDB CREDO	0.727	0.062	0.581	0.003
Rv2584c.1	1	1uwj_BAX_B_1723 PDB CREDO	0.594	0.187	0.576	0.003
Rv2584c.1	2	2h77_T3_A_1 PDB CREDO	0.638	0.136	0.576	0.003
Rv2584c.1	2	3oht_1N1_A_1000 PDB CREDO	0.640	0.134	0.574	0.003
Rv2584c.1	1	3mss_STI_C_1 PDB CREDO	0.588	0.193	0.571	0.004
Rv2584c.1	1	2hyy_STI_A_600 PDB CREDO	0.584	0.198	0.568	0.004
Rv2584c.1	1	3mss_STI_A_1 PDB CREDO	0.584	0.198	0.568	0.004
Rv2584c.1	2	2fum_MIX_A_539 PDB CREDO	0.588	0.193	0.568	0.004
Rv2584c.1	2	1gs4_ZK5_A_1918 PDB CREDO	0.587	0.195	0.566	0.004
Rv2584c.1	1	3ms9_STI_A_1 PDB CREDO	0.582	0.201	0.566	0.004
Rv2584c.1	1	2hyy_STI_D_600 PDB CREDO	0.582	0.201	0.565	0.004
Rv2584c.1	1	3mss_STI_B_1 PDB CREDO	0.582	0.201	0.565	0.004
Rv2584c.1	1	3pyy_STI_A_3 PDB CREDO	0.582	0.201	0.565	0.004
Rv2584c.1	1	2hyy_STI_C_600 PDB CREDO	0.581	0.202	0.564	0.004
Rv2584c.1	1	3mss_STI_D_1 PDB CREDO	0.581	0.202	0.564	0.004
Rv2584c.1	1	3pyy_STI_B_4 PDB CREDO	0.581	0.202	0.564	0.004
Rv2584c.1	1	1iep_STI_B_202 PDB CREDO	0.581	0.203	0.564	0.004
Rv2584c.1	2	3uvv_T3_A_501 PDB CREDO	0.690	0.089	0.564	0.004
Rv2584c.1	1	3k5v_STI_B_2 PDB CREDO	0.580	0.204	0.564	0.004
Rv2584c.1	2	3gws_T3_X_500 PDB CREDO	0.667	0.108	0.563	0.004
Rv2584c.1	1	1iep_STI_A_201 PDB CREDO	0.580	0.204	0.563	0.004
Rv2584c.1	1	3ms9_STI_B_1 PDB CREDO	0.579	0.205	0.562	0.004
Rv2584c.1	2	1bsx_T3_A_1 PDB CREDO	0.666	0.109	0.562	0.004
Rv2584c.1	2	1bsx_T3_B_2 PDB CREDO	0.666	0.109	0.562	0.004
Rv2584c.1	2	1fm6_BRL_D_503 PDB CREDO	0.562	0.227	0.562	0.004
Rv2584c.1	1	3gvu_STI_A_1001 PDB CREDO	0.577	0.207	0.561	0.004
Rv2584c.1	2	1ya3_STR_A_1001 PDB CREDO	0.580	0.204	0.560	0.004
Rv2584c.1	2	1xzx_T3_X_500 PDB CREDO	0.684	0.094	0.559	0.004
Rv2584c.1	2	1mx1_THA_B_2 PDB CREDO	0.758	0.044	0.558	0.004
Rv2584c.1	2	1zgy_BRL_A_503 PDB CREDO	0.618	0.158	0.558	0.004
Rv2584c.1	2	2xkw_P1B_B_1475 PDB CREDO	0.577	0.207	0.557	0.004
Rv2584c.1	2	3oct_1N1_A_663 PDB CREDO	0.576	0.209	0.556	0.005
Rv2584c.1	2	3k54_1N1_A_1 PDB CREDO	0.596	0.184	0.555	0.005
Rv2584c.1	2	3adx_IMN_B_3 PDB CREDO	0.721	0.066	0.553	0.005
Rv2584c.1	2	3h52_486_C_4 PDB CREDO	0.573	0.213	0.553	0.005
Rv2584c.1	2	3oll_EST_B_600 PDB CREDO	0.816	0.019	0.553	0.005
Rv2584c.1	2	2h79_T3_A_1 PDB CREDO	0.633	0.141	0.552	0.005
Rv2584c.1	2	2gqg_1N1_A_501 PDB CREDO	0.572	0.214	0.552	0.005
Rv2584c.1	2	2prg_BRL_A_1 PDB CREDO	0.552	0.241	0.552	0.005
Rv2584c.1	2	1ere_EST_D_600 PDB CREDO	0.813	0.020	0.551	0.005
Rv2584c.1	2	3oll_EST_A_600 PDB CREDO	0.813	0.020	0.551	0.005
Rv2584c.1	2	1ere_EST_F_600 PDB CREDO	0.811	0.021	0.549	0.005
Rv2584c.1	2	1pcg_EST_A_1 PDB CREDO	0.811	0.021	0.549	0.005
Rv2584c.1	2	1ere_EST_C_600 PDB CREDO	0.810	0.021	0.549	0.005
Rv2584c.1	1	1uwh_BAX_A_1723 PDB CREDO	0.600	0.179	0.549	0.005
Rv2584c.1	1	2hyy_STI_B_600 PDB CREDO	0.582	0.201	0.549	0.005
Rv2584c.1	2	1nhz_486_A_800 PDB CREDO	0.608	0.170	0.548	0.005
Rv2584c.1	1	1uwh_BAX_B_1723 PDB CREDO	0.599	0.180	0.548	0.005
Rv2584c.1	2	1a52_EST_A_1 PDB CREDO	0.809	0.022	0.548	0.005
Rv2584c.1	2	1a52_EST_B_2 PDB CREDO	0.809	0.022	0.548	0.005
Rv2584c.1	1	4asd_BAX_A_1500 PDB CREDO	0.563	0.226	0.547	0.005
Rv2584c.1	2	2j7x_EST_A_1454 PDB CREDO	0.807	0.022	0.546	0.005
Rv2584c.1	2	3heg_BAX_A_1 PDB CREDO	0.757	0.044	0.546	0.005
Rv2584c.1	2	1qkt_EST_A_600 PDB CREDO	0.806	0.023	0.546	0.005
Rv2584c.1	2	2q1v_PDN_A_248 PDB CREDO	0.565	0.223	0.546	0.005
Rv2584c.1	1	2vn1_FK5_A_501 PDB CREDO	0.611	0.166	0.546	0.005
Rv2584c.1	2	3hm1_J3Z_B_1 PDB CREDO	0.805	0.023	0.545	0.005
Rv2584c.1	2	2ocf_EST_A_596 PDB CREDO	0.804	0.023	0.544	0.005
Rv2584c.1	2	1jg3_ADN_A_500 PDB CREDO	0.585	0.198	0.544	0.006
Rv2584c.1	1	3oez_STI_A_601 PDB CREDO	0.560	0.231	0.544	0.006
Rv2584c.1	2	3qt0_486_A_4 PDB CREDO	0.580	0.204	0.541	0.006
Rv2584c.1	11	2uxp_CLM_B_1211 PDB CREDO	0.540	0.258	0.540	0.006
Rv2584c.1	2	3lfa_1N1_A_361 PDB CREDO	0.764	0.040	0.540	0.006
Rv2584c.1	2	1a28_STR_A_1 PDB CREDO	0.539	0.260	0.539	0.006
Rv2584c.1	2	1g50_EST_C_2600 PDB CREDO	0.796	0.026	0.539	0.006
Rv2584c.1	2	2ito_IRE_A_2020 PDB CREDO	0.623	0.153	0.538	0.006
Rv2584c.1	11	1jlb_NVP_A_999 PDB CREDO	0.562	0.227	0.537	0.006
Rv2584c.1	2	2w8y_NDR_B_1000 PDB CREDO	0.672	0.104	0.537	0.006
Rv2584c.1	1	1uob_PNN_A_1311 PDB CREDO	0.569	0.218	0.537	0.006
Rv2584c.1	2	1ya3_STR_B_2001 PDB CREDO	0.556	0.236	0.537	0.006
Rv2584c.1	1	3k5v_STI_A_2 PDB CREDO	0.584	0.199	0.536	0.006
Rv2584c.1	2	2prg_BRL_B_2 PDB CREDO	0.534	0.266	0.534	0.006
Rv2584c.1	1	1opj_STI_B_4 PDB CREDO	0.598	0.181	0.534	0.006
Rv2584c.1	2	3rif_IVM_A_403 PDB CREDO	0.553	0.240	0.533	0.007
Rv2584c.1	2	3ri5_IVM_C_350 PDB CREDO	0.552	0.241	0.533	0.007
Rv2584c.1	2	3rif_IVM_A_402 PDB CREDO	0.552	0.241	0.533	0.007
Rv2584c.1	1	1kij_NOV_A_400 PDB CREDO	0.729	0.060	0.532	0.007
Rv2584c.1	2	2uxo_TAC_B_1211 PDB CREDO	0.693	0.086	0.532	0.007
Rv2584c.1	2	3rif_IVM_D_402 PDB CREDO	0.551	0.242	0.532	0.007
Rv2584c.1	2	3ria_IVM_C_349 PDB CREDO	0.551	0.243	0.531	0.007
Rv2584c.1	11	1pbc_BHA_A_396 PDB CREDO	0.555	0.237	0.530	0.007
Rv2584c.1	2	3rif_IVM_B_403 PDB CREDO	0.549	0.245	0.530	0.007
Rv2584c.1	2	3v5w_8PR_A_701 PDB CREDO	0.628	0.147	0.530	0.007
Rv2584c.1	11	2bxp_P1Z_A_3001 PDB CREDO	0.555	0.237	0.530	0.007
Rv2584c.1	1	1opj_STI_A_3 PDB CREDO	0.593	0.188	0.529	0.007
Rv2584c.1	1	3cs9_NIL_A_600 PDB CREDO	0.593	0.188	0.529	0.007
Rv2584c.1	2	3ln1_CEL_D_682 PDB CREDO	0.567	0.221	0.529	0.007
Rv2584c.1	2	1d4s_TPV_A_201 PDB CREDO	0.586	0.196	0.529	0.007
Rv2584c.1	1	2oiq_STI_A_1001 PDB CREDO	0.560	0.230	0.528	0.007
Rv2584c.1	2	2zva_1N1_A_513 PDB CREDO	0.660	0.114	0.528	0.007
Rv2584c.1	2	1a28_STR_B_2 PDB CREDO	0.644	0.130	0.526	0.007
Rv2584c.1	1	3nxu_RIT_A_600 PDB CREDO	0.606	0.172	0.526	0.007
Rv2584c.1	2	3h52_486_A_3 PDB CREDO	0.706	0.076	0.525	0.007
Rv2584c.1	2	2h42_VIA_A_901 PDB CREDO	0.563	0.227	0.525	0.007
Rv2584c.1	2	3gcs_BAX_A_401 PDB CREDO	0.747	0.049	0.524	0.008
Rv2584c.1	2	3spk_TPV_B_100 PDB CREDO	0.769	0.038	0.523	0.008
Rv2584c.1	2	2h42_VIA_C_903 PDB CREDO	0.541	0.257	0.522	0.008
Rv2584c.1	1	3d91_REM_A_350 PDB CREDO	0.537	0.263	0.521	0.008
Rv2584c.1	2	2y6o_1N1_A_1892 PDB CREDO	0.638	0.137	0.521	0.008
Rv2584c.1	11	2uxp_CLM_A_1211 PDB CREDO	0.521	0.286	0.521	0.008
Rv2584c.1	2	3jwq_VIA_D_901 PDB CREDO	0.558	0.233	0.521	0.008
Rv2584c.1	2	3g5d_1N1_B_1 PDB CREDO	0.627	0.149	0.521	0.008
Rv2584c.1	2	1ya3_STR_C_3001 PDB CREDO	0.559	0.232	0.520	0.008
Rv2584c.1	2	3qlg_1N1_A_601 PDB CREDO	0.626	0.149	0.520	0.008
Rv2584c.1	1	3cs9_NIL_B_600 PDB CREDO	0.598	0.181	0.519	0.008
Rv2584c.1	1	3nxu_RIT_B_600 PDB CREDO	0.598	0.181	0.519	0.008
Rv2584c.1	2	1mx1_THA_A_1 PDB CREDO	0.735	0.057	0.519	0.008
Rv2584c.1	1	2pl0_STI_A_200 PDB CREDO	0.551	0.243	0.519	0.008
Rv2584c.1	2	3g5d_1N1_A_1 PDB CREDO	0.624	0.152	0.518	0.008
Rv2584c.1	2	3qlg_1N1_B_601 PDB CREDO	0.621	0.154	0.516	0.009
Rv2584c.1	2	3ads_IMN_B_3 PDB CREDO	0.760	0.042	0.515	0.009
Rv2584c.1	1	3d91_REM_B_350 PDB CREDO	0.530	0.272	0.515	0.009
Rv2584c.1	2	1sa1_POD_D_701 PDB CREDO	0.712	0.072	0.514	0.009
Rv2584c.1	3	3kp6_SAL_A_3002 PDB CREDO	0.589	0.193	0.514	0.009
Rv2584c.1	2	3e22_LOC_B_700 PDB CREDO	0.649	0.125	0.514	0.009
Rv2584c.1	2	3kw2_ADN_B_300 PDB CREDO	0.642	0.132	0.513	0.009
Rv2584c.1	1	3cs9_NIL_C_600 PDB CREDO	0.623	0.153	0.513	0.009
Rv2584c.1	1	3cs9_NIL_D_600 PDB CREDO	0.623	0.153	0.513	0.009
Rv2584c.1	2	1lhu_EST_A_301 PDB CREDO	0.513	0.299	0.513	0.009
Rv2584c.1	2	3sxr_1N1_A_1 PDB CREDO	0.642	0.133	0.513	0.009
Rv2584c.1	2	3e22_LOC_D_700 PDB CREDO	0.647	0.128	0.512	0.009
Rv2584c.1	2	1y0x_T44_X_500 PDB CREDO	0.688	0.090	0.512	0.009
Rv2584c.1	2	3oez_STI_B_601 PDB CREDO	0.645	0.129	0.511	0.009
Rv2584c.1	1	3oez_STI_B_601 PDB CREDO	0.594	0.187	0.510	0.009
Rv2584c.1	2	4asd_BAX_A_1500 PDB CREDO	0.728	0.061	0.510	0.009
Rv2584c.1	2	3jwq_VIA_B_901 PDB CREDO	0.529	0.275	0.510	0.009
Rv2584c.1	1	2x9g_LYA_A_1270 PDB CREDO	0.612	0.164	0.510	0.009
Rv2584c.1	2	2cbr_A80_A_201 PDB CREDO	0.568	0.219	0.509	0.009
Rv2584c.1	2	2qxs_RAL_A_600 PDB CREDO	0.862	0.008	0.509	0.009
Rv2584c.1	1	1z2b_VLB_C_800 PDB CREDO	0.540	0.259	0.509	0.010
Rv2584c.1	1	3ua1_08Y_A_600 PDB CREDO	0.611	0.166	0.509	0.010
Rv2584c.1	2	2qxs_RAL_B_600 PDB CREDO	0.860	0.008	0.508	0.010
Rv2584c.1	2	2fum_MIX_B_1539 PDB CREDO	0.662	0.113	0.508	0.010
Rv2584c.1	2	1fm6_BRL_X_504 PDB CREDO	0.622	0.154	0.508	0.010
Rv2584c.1	1	2jfa_RAL_A_600 PDB CREDO	0.591	0.190	0.508	0.010
Rv2584c.1	2	2w8y_486_A_1000 PDB CREDO	0.724	0.063	0.507	0.010
Rv2584c.1	2	2oiq_STI_A_1001 PDB CREDO	0.702	0.079	0.507	0.010
Rv2584c.1	2	3d90_NOG_A_1001 PDB CREDO	0.561	0.228	0.506	0.010
Rv2584c.1	2	3d90_NOG_B_2001 PDB CREDO	0.560	0.230	0.505	0.010
Rv2584c.1	11	3f8w_ADN_A_300 PDB CREDO	0.504	0.312	0.504	0.010
Rv2584c.1	1	1err_RAL_B_600 PDB CREDO	0.568	0.219	0.504	0.010
Rv2584c.1	1	3tne_RIT_A_401 PDB CREDO	0.586	0.196	0.504	0.010
Rv2584c.1	1	3tne_RIT_B_401 PDB CREDO	0.586	0.196	0.504	0.010
Rv2584c.1	2	3h52_486_D_2 PDB CREDO	0.676	0.100	0.503	0.010
Rv2584c.1	2	1sa1_POD_B_700 PDB CREDO	0.717	0.068	0.503	0.010
Rv2584c.1	11	3f8w_ADN_B_301 PDB CREDO	0.502	0.315	0.502	0.011
Rv2584c.1	2	2pl0_STI_A_200 PDB CREDO	0.695	0.085	0.502	0.011
Rv2584c.1	1	3heg_BAX_A_1 PDB CREDO	0.532	0.270	0.501	0.011
Rv2584c.1	11	2x7h_PFN_A_1372 PDB CREDO	0.525	0.280	0.501	0.011
Rv2584c.1	11	4dt8_ADN_A_401 PDB CREDO	0.524	0.281	0.501	0.011

Similarity to known drug target from sensitive sequence analysis

No drug targets

List of small molecules tested from TIBLE

Data not available

Off-target activity - ligand based from TIBLE

Data not available

Small molecules involved in protein-protein complex from TIMBAL .Proteins similar to Mtb based on sequence analysis.

Data not available

STITCH interactions

Chemical Name	Confidence score	Molecular Weight
phosphoribosylpyrophosphatePubChem	0.993	390.07
adeninePubChem	0.993	135.127
adenosine monophosphatePubChem	0.985	347.221
guaninePubChem	0.972	151.126
phosphatePubChem	0.971	96.9872
D-ribose 5-phosphatePubChem	0.965	230.11
guanylatePubChem	0.954	363.221
pyrophosphatePubChem	0.945	177.975
deoxyadenosinePubChem	0.937	251.242
hydroxyl radicalsPubChem	0.9	17.0073
adenine-desoxyribosidePubChem	0.9	251.242
aminoimidazole carboxamide ribonucleotidePubChem	0.9	338.211
2-deoxy-alpha-D-ribose 1-phosphatePubChem	0.9	214.11
5-aminoimidazole-4-carboxamide ribosidePubChem	0.9	338.211
deoxyribose-1-phosphatePubChem	0.9	214.11
theophyllinePubChem	0.803	180.164
magnesiumPubChem	0.785	24.305
2,6-diaminopurinePubChem	0.767	240.219
hypoxanthinePubChem	0.762	136.111
8-azaguaninePubChem	0.754	152.114
isoproterenolPubChem	0.745	211.258
prostaglandin E1PubChem	0.734	354.481
inosine monophosphatePubChem	0.706	348.206