SInCRe - Rv2583c

Tuberculist information

Gene name	relA
Protein function	Probable GTP pyrophosphokinase RelA (ATP:GTP 3'- pyrophosphotransferase) (PPGPP synthetase I) ((P)PPGPP synthetase) (GTP diphosphokinase)
Functional category(tuberculist)	intermediary metabolism and respiration
Gene location(kb)	2907.83
Molecular mass(da)	87321.8
External sites	TB Database TubercuList WebTB

Protein sequence

Number of amino acids : 790

	  		  	1    VAEDQLTAQAVAPPTEASAALEPALETPESPVETLKTSISASRRVRARLARRMTAQRSTT   60
			  	61   NPVLEPLVAVHREIYPKADLSILQRAYEVADQRHASQLRQSGDPYITHPLAVANILAELG  120
			  	121  MDTTTLVAALLHDTVEDTGYTLEALTEEFGEEVGHLVDGVTKLDRVVLGSAAEGETIRKM  180
			  	181  ITAMARDPRVLVIKVADRLHNMRTMRFLPPEKQARKARETLEVIAPLAHRLGMASVKWEL  240
			  	241  EDLSFAILHPKKYEEIVRLVAGRAPSRDTYLAKVRAEIVNTLTASKIKATVEGRPKHYWS  300
			  	301  IYQKMIVKGRDFDDIHDLVGVRILCDEIRDCYAAVGVVHSLWQPMAGRFKDYIAQPRYGV  360
			  	361  YQSLHTTVVGPEGKPLEVQIRTRDMHRTAEYGIAAHWRYKEAKGRNGVLHPHAAAEIDDM  420
			  	421  AWMRQLLDWQREAADPGEFLESLRYDLAVQEIFVFTPKGDVITLPTGSTPVDFAYAVHTE  480
			  	481  VGHRCIGARVNGRLVALERKLENGEVVEVFTSKAPNAGPSRDWQQFVVSPRAKTKIRQWF  540
			  	541  AKERREEALETGKDAMAREVRRGGLPLQRLVNGESMAAVARELHYADVSALYTAIGEGHV  600
			  	601  SAKHVVQRLLAELGGIDQAEEELAERSTPATMPRRPRSTDDVGVSVPGAPGVLTKLAKCC  660
			  	661  TPVPGDVIMGFVTRGGGVSVHRTDCTNAASLQQQAERIIEVLWAPSPSSVFLVAIQVEAL  720
			  	721  DRHRLLSDVTRALADEKVNILSASVTTSGDRVAISRFTFEMGDPKHLGHLLNAVRNVEGV  780
			  	781  YDVYRVTSAA

Known structures in the PDB

No Known structures

Number of amino acids : 790

Domains assigned based on sequence.

Mtb Structural proteome models

CHOPIN models

Profile-based domain assignment

Structural/Functional domain family	Pfam acc.no./SCOP ID	Domain Region
HD_4	PF13328	86-234
RelA_SpoT	PF04607	293-404
TGS	PF02824	452-511
ACT_4	PF13291	707-785

Mtb Structural Proteome models

Model Number	1
Model name	Rv2583c.5
Template	2FGC APDB CREDO
Template coverage	30_101
Template Identity(%)	15.3
Model coverage(%)	9.0
Normalized DOPE score	-1.226

Model Number	2
Model name	Rv2583c.6
Template	2F1F APDB CREDO
Template coverage	5_80
Template Identity(%)	21.1
Model coverage(%)	9.5
Normalized DOPE score	-0.786

Model Number	3
Model name	Rv2583c
Template	1VJ7 APDB CREDO
Template coverage	10_364
Template Identity(%)	48.1
Model coverage(%)	42.0
Normalized DOPE score	-0.646

Model Number	4
Model name	Rv2583c.3
Template	1WWT APDB CREDO
Template coverage	8_87
Template Identity(%)	21.2
Model coverage(%)	10.6
Normalized DOPE score	0.092

Model Number	5
Model name	Rv2583c.2
Template	2BE3 APDB CREDO
Template coverage	4_202
Template Identity(%)	21.1
Model coverage(%)	23.9
Normalized DOPE score	0.295

Model Number	6
Model name	Rv2583c.4
Template	1TKE APDB CREDO
Template coverage	4_218
Template Identity(%)	16.3
Model coverage(%)	30.0
Normalized DOPE score	0.403

Structure Models from Chopin

Model Number	1
Profile	d.218.1.8 Click for model details
zscore	20.66
Residue begin	250
Residue end	438

Model Number	2
Profile	d.15.10.2 Click for model details
zscore	14.5
Residue begin	451
Residue end	515

Model Number	3
Profile	d.58.18.12 Click for model details
zscore	12.27
Residue begin	712
Residue end	784

Binding pockets

STRING

Cytoscape Web will replace the contents of this div with protein-protein interaction network.

Protein interacting with Rv2583c	Gene name	Confidence Score
Rv0667	rpoB	0.987
Rv0667	rpoB	0.987
Rv3457c	rpoA	0.987
Rv3457c	rpoA	0.987
Rv0667	rpoB	0.987
Rv3457c	rpoA	0.987
Rv0667	rpoB	0.987
Rv0667	rpoB	0.987
Rv0667	rpoB	0.987
Rv2584c	apt	0.986
Rv0668	rpoC	0.959
Rv0668	rpoC	0.959
Rv0668	rpoC	0.959
Rv0668	rpoC	0.959
Rv0668	rpoC	0.959
Rv1617	pykA	0.956
Rv1617	pykA	0.956
Rv2445c	ndkA	0.954
Rv1021	Rv1021	0.952
Rv1026	Rv1026	0.946
Rv0496	Rv0496	0.928
Rv1897c	Rv1897c	0.901

Potential ligand/drug binding sites

Protein Model	Pocket Number	Drug Binding Site	PMIN Score	Pvalue PMIN	PMAX Score	Pvalue PMAX
Rv2583c.3	1	1xkk_FMM_A_91 PDB CREDO	0.662	0.113	0.645	0.001
Rv2583c.3	1	1t46_STI_A_3 PDB CREDO	0.659	0.115	0.642	0.001
Rv2583c.4	5	3spk_TPV_B_100 PDB CREDO	0.656	0.119	0.637	0.001
Rv2583c.3	1	3gp0_NIL_A_1 PDB CREDO	0.625	0.151	0.625	0.001
Rv2583c.4	5	4asd_BAX_A_1500 PDB CREDO	0.614	0.163	0.614	0.002
Rv2583c.5	5	1e7b_HLT_B_4003 PDB CREDO	0.656	0.119	0.611	0.002
Rv2583c.5	5	1e7b_HLT_A_4003 PDB CREDO	0.653	0.121	0.608	0.002
Rv2583c.4	5	3gcs_BAX_A_401 PDB CREDO	0.604	0.174	0.604	0.002
Rv2583c.3	1	3cs9_NIL_C_600 PDB CREDO	0.620	0.156	0.604	0.002
Rv2583c.3	1	3cs9_NIL_D_600 PDB CREDO	0.617	0.159	0.601	0.002
Rv2583c.3	1	2qxs_RAL_A_600 PDB CREDO	0.642	0.133	0.592	0.002
Rv2583c.4	5	1t7j_478_A_200 PDB CREDO	0.629	0.146	0.592	0.002
Rv2583c.3	1	2qxs_RAL_B_600 PDB CREDO	0.641	0.134	0.591	0.002
Rv2583c.4	5	1sa1_POD_B_700 PDB CREDO	0.590	0.191	0.590	0.003
Rv2583c.3	1	1uwj_BAX_A_1723 PDB CREDO	0.693	0.086	0.589	0.003
Rv2583c.3	1	2xkw_P1B_A_1478 PDB CREDO	0.619	0.157	0.588	0.003
Rv2583c.2	6	1c6z_ROC_B_505 PDB CREDO	0.602	0.177	0.587	0.003
Rv2583c.4	5	1n49_RIT_D_401 PDB CREDO	0.620	0.156	0.585	0.003
Rv2583c.4	5	3so9_017_A_100 PDB CREDO	0.617	0.159	0.581	0.003
Rv2583c.4	5	3hec_STI_A_1 PDB CREDO	0.654	0.121	0.579	0.003
Rv2583c.3	1	1opj_STI_A_3 PDB CREDO	0.643	0.131	0.578	0.003
Rv2583c.4	5	2y6o_1N1_A_1892 PDB CREDO	0.672	0.104	0.576	0.003
Rv2583c.3	1	3cs9_NIL_B_600 PDB CREDO	0.623	0.153	0.575	0.003
Rv2583c.4	5	3heg_BAX_A_1 PDB CREDO	0.590	0.191	0.573	0.003
Rv2583c.4	5	3spk_TPV_A_100 PDB CREDO	0.737	0.056	0.572	0.003
Rv2583c.3	1	3bjw_SVR_E_503 PDB CREDO	0.602	0.177	0.571	0.004
Rv2583c.3	1	1opj_STI_B_4 PDB CREDO	0.635	0.140	0.570	0.004
Rv2583c.3	1	3cs9_NIL_A_600 PDB CREDO	0.634	0.140	0.570	0.004
Rv2583c.4	5	1sa1_POD_D_701 PDB CREDO	0.587	0.195	0.569	0.004
Rv2583c.4	5	1uwj_BAX_B_1723 PDB CREDO	0.569	0.218	0.569	0.004
Rv2583c.3	1	3sm2_478_A_126 PDB CREDO	0.614	0.163	0.568	0.004
Rv2583c.4	5	1hwk_117_B_1 PDB CREDO	0.601	0.177	0.567	0.004
Rv2583c.3	1	3oez_STI_A_601 PDB CREDO	0.681	0.096	0.562	0.004
Rv2583c.4	5	1uwj_BAX_A_1723 PDB CREDO	0.613	0.164	0.562	0.004
Rv2583c.4	5	1hwk_117_A_2 PDB CREDO	0.561	0.228	0.561	0.004
Rv2583c.3	1	4asd_BAX_A_1500 PDB CREDO	0.721	0.066	0.561	0.004
Rv2583c.3	1	3k5v_STI_A_2 PDB CREDO	0.642	0.132	0.561	0.004
Rv2583c.4	5	1hwk_117_C_4 PDB CREDO	0.560	0.230	0.560	0.004
Rv2583c.3	1	3bjw_SVR_B_501 PDB CREDO	0.574	0.212	0.559	0.004
Rv2583c.4	5	1n49_RIT_B_301 PDB CREDO	0.645	0.130	0.559	0.004
Rv2583c.2	6	1rl8_RIT_A_9001 PDB CREDO	0.559	0.232	0.559	0.004
Rv2583c.3	1	3bjw_SVR_H_504 PDB CREDO	0.572	0.214	0.557	0.004
Rv2583c.3	1	3ufn_ROC_A_401 PDB CREDO	0.557	0.234	0.557	0.004
Rv2583c.4	5	1t46_STI_A_3 PDB CREDO	0.697	0.083	0.557	0.004
Rv2583c.5	5	3re0_CPT_C_201 PDB CREDO	0.598	0.182	0.557	0.004
Rv2583c.3	1	3el9_DR7_A_100 PDB CREDO	0.585	0.197	0.555	0.005
Rv2583c.4	5	1hwl_FBI_B_1 PDB CREDO	0.572	0.215	0.555	0.005
Rv2583c.4	5	1hwl_FBI_D_3 PDB CREDO	0.572	0.215	0.555	0.005
Rv2583c.2	6	1xkk_FMM_A_91 PDB CREDO	0.613	0.164	0.554	0.005
Rv2583c.3	1	3mss_STI_B_1 PDB CREDO	0.670	0.105	0.553	0.005
Rv2583c.3	1	3pyy_STI_A_3 PDB CREDO	0.670	0.105	0.553	0.005
Rv2583c.4	5	3v5w_8PR_A_701 PDB CREDO	0.666	0.109	0.553	0.005
Rv2583c.3	1	3pyy_STI_B_4 PDB CREDO	0.670	0.106	0.553	0.005
Rv2583c.3	1	1iep_STI_B_202 PDB CREDO	0.670	0.106	0.553	0.005
Rv2583c.3	1	3k5v_STI_B_2 PDB CREDO	0.669	0.106	0.552	0.005
Rv2583c.3	1	3gvu_STI_A_1001 PDB CREDO	0.668	0.107	0.552	0.005
Rv2583c.2	6	1t46_STI_A_3 PDB CREDO	0.642	0.132	0.551	0.005
Rv2583c.3	1	1iep_STI_A_201 PDB CREDO	0.667	0.108	0.551	0.005
Rv2583c.3	1	3ms9_STI_A_1 PDB CREDO	0.667	0.108	0.551	0.005
Rv2583c.3	1	3ms9_STI_B_1 PDB CREDO	0.667	0.108	0.551	0.005
Rv2583c.3	1	3mss_STI_A_1 PDB CREDO	0.667	0.108	0.551	0.005
Rv2583c.3	1	3bjw_SVR_F_502 PDB CREDO	0.565	0.223	0.551	0.005
Rv2583c.3	1	2hyy_STI_D_600 PDB CREDO	0.667	0.108	0.551	0.005
Rv2583c.3	1	3mss_STI_C_1 PDB CREDO	0.667	0.108	0.551	0.005
Rv2583c.4	5	1uwh_BAX_A_1723 PDB CREDO	0.584	0.198	0.550	0.005
Rv2583c.4	5	2hyy_STI_B_600 PDB CREDO	0.567	0.221	0.550	0.005
Rv2583c.4	5	3oez_STI_B_601 PDB CREDO	0.622	0.154	0.550	0.005
Rv2583c.4	5	1uwh_BAX_B_1723 PDB CREDO	0.584	0.199	0.550	0.005
Rv2583c.5	5	3re0_CPT_B_201 PDB CREDO	0.632	0.143	0.549	0.005
Rv2583c.3	1	3mss_STI_D_1 PDB CREDO	0.665	0.110	0.549	0.005
Rv2583c.4	5	3gp0_NIL_A_1 PDB CREDO	0.705	0.077	0.549	0.005
Rv2583c.3	1	2hyy_STI_A_600 PDB CREDO	0.664	0.111	0.548	0.005
Rv2583c.4	5	1xkk_FMM_A_91 PDB CREDO	0.723	0.065	0.548	0.005
Rv2583c.2	6	3gp0_NIL_A_1 PDB CREDO	0.622	0.154	0.548	0.005
Rv2583c.4	5	1hwl_FBI_A_2 PDB CREDO	0.564	0.224	0.548	0.005
Rv2583c.3	1	2hyy_STI_C_600 PDB CREDO	0.663	0.112	0.548	0.005
Rv2583c.4	5	3ut5_LOC_B_502 PDB CREDO	0.581	0.202	0.547	0.005
Rv2583c.3	1	3b0w_DGX_B_1 PDB CREDO	0.626	0.149	0.547	0.005
Rv2583c.4	5	1hwl_FBI_C_4 PDB CREDO	0.563	0.226	0.547	0.005
Rv2583c.3	1	1uwj_BAX_B_1723 PDB CREDO	0.700	0.081	0.545	0.005
Rv2583c.4	5	1hwi_115_D_3 PDB CREDO	0.615	0.161	0.544	0.005
Rv2583c.4	5	3oez_STI_A_601 PDB CREDO	0.576	0.208	0.544	0.006
Rv2583c.4	5	1c6y_MK1_B_524 PDB CREDO	0.660	0.115	0.542	0.006
Rv2583c.3	1	3gcs_BAX_A_401 PDB CREDO	0.695	0.084	0.541	0.006
Rv2583c.3	1	1c6z_ROC_B_505 PDB CREDO	0.598	0.181	0.540	0.006
Rv2583c.4	5	1hwk_117_D_3 PDB CREDO	0.574	0.212	0.540	0.006
Rv2583c.4	5	1hwi_115_B_1 PDB CREDO	0.610	0.167	0.540	0.006
Rv2583c.3	1	2hyy_STI_B_600 PDB CREDO	0.713	0.071	0.539	0.006
Rv2583c.4	5	3ut5_LOC_D_502 PDB CREDO	0.607	0.171	0.537	0.006
Rv2583c.4	5	3ekq_ROC_A_100 PDB CREDO	0.636	0.139	0.536	0.006
Rv2583c.4	5	3el0_1UN_A_201 PDB CREDO	0.599	0.180	0.534	0.006
Rv2583c.3	1	2fxd_DR7_A_102 PDB CREDO	0.563	0.226	0.534	0.006
Rv2583c.3	1	2oiq_STI_A_1001 PDB CREDO	0.706	0.077	0.533	0.007
Rv2583c.4	5	3ogp_017_A_200 PDB CREDO	0.549	0.245	0.533	0.007
Rv2583c.4	5	2oiq_STI_A_1001 PDB CREDO	0.549	0.246	0.532	0.007
Rv2583c.2	4	1jlb_NVP_A_999 PDB CREDO	0.557	0.234	0.532	0.007
Rv2583c.4	5	2r5q_1UN_B_900 PDB CREDO	0.547	0.248	0.531	0.007
Rv2583c.4	5	2pl0_STI_A_200 PDB CREDO	0.546	0.249	0.530	0.007
Rv2583c.4	5	2r5q_1UN_D_900 PDB CREDO	0.546	0.249	0.530	0.007
Rv2583c.3	1	3heg_BAX_A_1 PDB CREDO	0.701	0.080	0.530	0.007
Rv2583c.2	6	2nnk_ROC_A_401 PDB CREDO	0.556	0.236	0.530	0.007
Rv2583c.2	6	1k6c_MK1_B_902 PDB CREDO	0.569	0.218	0.529	0.007
Rv2583c.4	5	3el9_DR7_A_100 PDB CREDO	0.645	0.130	0.529	0.007
Rv2583c.2	6	1c6y_MK1_B_524 PDB CREDO	0.634	0.141	0.529	0.007
Rv2583c.5	5	1xr3_ISZ_B_302 PDB CREDO	0.529	0.274	0.529	0.007
Rv2583c.2	6	3prs_RIT_A_1001 PDB CREDO	0.529	0.274	0.529	0.007
Rv2583c.3	1	2q64_1UN_B_1001 PDB CREDO	0.584	0.198	0.528	0.007
Rv2583c.4	5	3lzv_017_A_200 PDB CREDO	0.591	0.190	0.527	0.007
Rv2583c.4	5	3tne_RIT_A_401 PDB CREDO	0.595	0.185	0.526	0.007
Rv2583c.3	1	2pym_1UN_A_1001 PDB CREDO	0.582	0.202	0.525	0.007
Rv2583c.2	6	1hxb_ROC_A_100 PDB CREDO	0.538	0.261	0.525	0.007
Rv2583c.2	6	3el9_DR7_A_100 PDB CREDO	0.628	0.147	0.525	0.007
Rv2583c.3	1	2qak_1UN_A_1001 PDB CREDO	0.581	0.202	0.525	0.007
Rv2583c.2	6	1t7i_017_A_200 PDB CREDO	0.564	0.225	0.525	0.007
Rv2583c.3	1	1uwh_BAX_A_1723 PDB CREDO	0.716	0.069	0.525	0.007
Rv2583c.2	6	2pym_1UN_A_1001 PDB CREDO	0.538	0.262	0.525	0.007
Rv2583c.4	5	3pyy_STI_A_3 PDB CREDO	0.556	0.236	0.524	0.008
Rv2583c.3	1	1uwh_BAX_B_1723 PDB CREDO	0.715	0.070	0.524	0.008
Rv2583c.2	6	3pwr_ROC_A_401 PDB CREDO	0.536	0.264	0.523	0.008
Rv2583c.4	5	3tne_RIT_B_401 PDB CREDO	0.591	0.190	0.523	0.008
Rv2583c.3	1	2pyn_1UN_A_1001 PDB CREDO	0.579	0.205	0.523	0.008
Rv2583c.2	6	2qak_1UN_A_1001 PDB CREDO	0.536	0.264	0.523	0.008
Rv2583c.2	6	2q64_1UN_B_1001 PDB CREDO	0.535	0.265	0.522	0.008
Rv2583c.4	5	3ms9_STI_B_1 PDB CREDO	0.554	0.239	0.522	0.008
Rv2583c.2	6	3ndt_ROC_D_100 PDB CREDO	0.548	0.247	0.522	0.008
Rv2583c.3	1	3kk6_CEL_B_1701 PDB CREDO	0.565	0.223	0.522	0.008
Rv2583c.4	5	1jg2_ADN_A_500 PDB CREDO	0.718	0.068	0.521	0.008
Rv2583c.4	5	2fum_MIX_D_3539 PDB CREDO	0.694	0.086	0.521	0.008
Rv2583c.4	5	3oht_1N1_B_1000 PDB CREDO	0.744	0.051	0.521	0.008
Rv2583c.3	1	2q63_1UN_A_1001 PDB CREDO	0.577	0.208	0.521	0.008
Rv2583c.2	6	2pyn_1UN_A_1001 PDB CREDO	0.534	0.267	0.521	0.008
Rv2583c.4	5	2jfa_RAL_A_600 PDB CREDO	0.588	0.193	0.521	0.008
Rv2583c.2	6	2q63_1UN_A_1001 PDB CREDO	0.533	0.268	0.520	0.008
Rv2583c.3	1	3spk_TPV_B_100 PDB CREDO	0.648	0.126	0.520	0.008
Rv2583c.4	5	3pyy_STI_B_4 PDB CREDO	0.551	0.243	0.520	0.008
Rv2583c.3	1	1c6y_MK1_B_524 PDB CREDO	0.548	0.247	0.519	0.008
Rv2583c.4	5	3k5v_STI_B_2 PDB CREDO	0.550	0.244	0.519	0.008
Rv2583c.4	5	2hyy_STI_D_600 PDB CREDO	0.550	0.245	0.518	0.008
Rv2583c.4	5	3mss_STI_A_1 PDB CREDO	0.549	0.245	0.518	0.008
Rv2583c.4	5	3e22_LOC_B_700 PDB CREDO	0.585	0.197	0.518	0.008
Rv2583c.4	5	3e22_LOC_D_700 PDB CREDO	0.585	0.197	0.518	0.008
Rv2583c.2	4	1jkh_EFZ_A_999 PDB CREDO	0.617	0.159	0.518	0.008
Rv2583c.4	5	3mss_STI_D_1 PDB CREDO	0.549	0.246	0.518	0.008
Rv2583c.4	5	3mss_STI_B_1 PDB CREDO	0.548	0.246	0.517	0.008
Rv2583c.3	1	3ogq_AB1_A_200 PDB CREDO	0.544	0.252	0.517	0.008
Rv2583c.4	5	1iep_STI_A_201 PDB CREDO	0.548	0.247	0.517	0.008
Rv2583c.4	5	1iep_STI_B_202 PDB CREDO	0.548	0.247	0.517	0.008
Rv2583c.4	5	2hyy_STI_C_600 PDB CREDO	0.548	0.247	0.517	0.008
Rv2583c.4	5	3ms9_STI_A_1 PDB CREDO	0.548	0.247	0.517	0.008
Rv2583c.4	5	2hyy_STI_A_600 PDB CREDO	0.547	0.248	0.516	0.009
Rv2583c.4	5	3gvu_STI_A_1001 PDB CREDO	0.547	0.248	0.516	0.009
Rv2583c.4	5	3mss_STI_C_1 PDB CREDO	0.547	0.248	0.516	0.009
Rv2583c.3	1	3oez_STI_B_601 PDB CREDO	0.749	0.049	0.516	0.009
Rv2583c.4	5	1sgu_MK1_B_2632 PDB CREDO	0.547	0.249	0.516	0.009
Rv2583c.4	5	2o4n_TPV_A_300 PDB CREDO	0.545	0.252	0.513	0.009
Rv2583c.2	4	2x7h_PFN_A_1372 PDB CREDO	0.537	0.262	0.513	0.009
Rv2583c.3	1	3hec_STI_A_1 PDB CREDO	0.744	0.051	0.513	0.009
Rv2583c.3	1	2pl0_STI_A_200 PDB CREDO	0.677	0.100	0.511	0.009
Rv2583c.3	1	2y6o_1N1_A_1892 PDB CREDO	0.765	0.040	0.511	0.009
Rv2583c.4	5	1hwi_115_A_2 PDB CREDO	0.634	0.140	0.510	0.009
Rv2583c.3	1	3nxu_RIT_A_600 PDB CREDO	0.552	0.242	0.509	0.009
Rv2583c.2	6	3ogq_AB1_A_200 PDB CREDO	0.549	0.246	0.509	0.009
Rv2583c.2	4	2x1l_ADN_C_601 PDB CREDO	0.533	0.269	0.509	0.009
Rv2583c.4	5	3ogp_017_B_200 PDB CREDO	0.539	0.259	0.508	0.010
Rv2583c.4	5	2jfa_RAL_B_600 PDB CREDO	0.557	0.235	0.508	0.010
Rv2583c.3	1	3nxu_RIT_B_600 PDB CREDO	0.550	0.244	0.508	0.010
Rv2583c.4	5	1uob_PNN_A_1311 PDB CREDO	0.523	0.283	0.507	0.010
Rv2583c.3	1	3kk6_CEL_A_701 PDB CREDO	0.520	0.288	0.506	0.010
Rv2583c.2	4	2uxp_CLM_B_1211 PDB CREDO	0.506	0.309	0.506	0.010
Rv2583c.3	1	1y0x_T44_X_500 PDB CREDO	0.690	0.088	0.506	0.010
Rv2583c.2	4	1pbc_BHA_A_396 PDB CREDO	0.530	0.273	0.506	0.010
Rv2583c.4	5	2qxs_RAL_A_600 PDB CREDO	0.600	0.179	0.506	0.010
Rv2583c.4	5	2qxs_RAL_B_600 PDB CREDO	0.600	0.179	0.506	0.010
Rv2583c.4	5	1err_RAL_A_600 PDB CREDO	0.553	0.239	0.505	0.010
Rv2583c.4	5	3tkd_CYZ_B_267 PDB CREDO	0.537	0.263	0.505	0.010
Rv2583c.4	5	2nni_MTK_A_501 PDB CREDO	0.520	0.287	0.505	0.010
Rv2583c.4	5	2z54_AB1_A_200 PDB CREDO	0.520	0.287	0.505	0.010
Rv2583c.5	5	3c9j_308_B_101 PDB CREDO	0.542	0.255	0.505	0.010
Rv2583c.4	5	1hsh_MK1_C_402 PDB CREDO	0.615	0.161	0.505	0.010
Rv2583c.3	1	2jfa_RAL_B_600 PDB CREDO	0.710	0.073	0.505	0.010
Rv2583c.3	1	1err_RAL_A_600 PDB CREDO	0.710	0.074	0.504	0.010
Rv2583c.3	1	1err_RAL_B_600 PDB CREDO	0.709	0.074	0.504	0.010
Rv2583c.3	1	1n49_RIT_B_301 PDB CREDO	0.561	0.228	0.504	0.010
Rv2583c.2	6	1hxw_RIT_B_301 PDB CREDO	0.557	0.234	0.504	0.010
Rv2583c.2	6	2fxd_DR7_A_102 PDB CREDO	0.603	0.176	0.503	0.010
Rv2583c.2	4	2vuf_FUA_B_2001 PDB CREDO	0.527	0.277	0.503	0.010
Rv2583c.4	5	1hsh_MK1_A_401 PDB CREDO	0.613	0.164	0.503	0.010
Rv2583c.2	6	3k4v_ROC_D_201 PDB CREDO	0.553	0.239	0.503	0.010
Rv2583c.2	6	3el4_ROC_A_100 PDB CREDO	0.540	0.258	0.503	0.010
Rv2583c.2	4	2bxc_P1Z_B_2001 PDB CREDO	0.550	0.244	0.502	0.011
Rv2583c.3	1	1rl8_RIT_A_9001 PDB CREDO	0.570	0.217	0.502	0.011
Rv2583c.4	5	1d4y_TPV_A_501 PDB CREDO	0.533	0.268	0.502	0.011
Rv2583c.3	1	1skx_RFP_A_1 PDB CREDO	0.544	0.253	0.502	0.011
Rv2583c.4	5	1err_RAL_B_600 PDB CREDO	0.549	0.245	0.501	0.011
Rv2583c.3	1	1hwk_117_B_1 PDB CREDO	0.607	0.171	0.501	0.011
Rv2583c.3	1	2jfa_RAL_A_600 PDB CREDO	0.727	0.062	0.501	0.011

Similarity to known drug target from sensitive sequence analysis

No drug targets

List of small molecules tested from TIBLE

Data not available

Off-target activity - ligand based from TIBLE

Data not available

Small molecules involved in protein-protein complex from TIMBAL .Proteins similar to Mtb based on sequence analysis.

Data not available

STITCH interactions

Chemical Name	Confidence score	Molecular Weight
pppGppPubChem	0.977	683.14
guanosine tetraphosphatePubChem	0.972	603.16
guanosine diphosphatePubChem	0.953	443.201
guanosine triphosphatePubChem	0.944	523.18
pyrophosphatePubChem	0.935	177.975
phosphatePubChem	0.927	96.9872
adenosine triphosphatePubChem	0.916	507.181
H(+)PubChem	0.9	2.01588
deuteriumPubChem	0.9	2.01588
adenosine diphosphatePubChem	0.9	427.201
protiumPubChem	0.9	2.01576
hydroxyl radicalsPubChem	0.9	17.0073
adenosine monophosphatePubChem	0.9	347.221
undecylprodigiosinPubChem	0.76	393.565
actinorhodinPubChem	0.749	634.54