SInCRe - Rv3624c

Tuberculist information

Gene name	hpt
Protein function	Hypoxanthine-guanine phosphoribosyltransferase Hpt (HGPRT) (HGPRTase) (hypoxanthine phosphoribosyltransferase) (imp pyrophosphorylase) (imp diphosphorylase) (transphosphoribosyltransferase) (guanine phosphoribosyltransferase)
Functional category(tuberculist)	intermediary metabolism and respiration
Gene location(kb)	4063.25
Molecular mass(da)	23603.8
External sites	TB Database TubercuList WebTB

Protein sequence

Number of amino acids : 216

	  		  	1    LTPALVVGPAAWHAVHVTQSSSAITPGQTAELYPGDIKSVLLTAEQIQARIAELGEQIGN   60
			  	61   DYRELSATTGQDLLLITVLKGAVLFVTDLARAIPVPTQFEFMAVSSYGSSTSSSGVVRIL  120
			  	121  KDLDRDIHGRDVLIVEDVVDSGLTLSWLSRNLTSRNPRSLRVCTLLRKPDAVHANVEIAY  180
			  	181  VGFDIPNDFVVGYGLDYDERYRDLSYIGTLDPRVYQ

Known structures in the PDB

No Known structures

Number of amino acids : 216

Domains assigned based on sequence.

Mtb Structural proteome models

CHOPIN models

Profile-based domain assignment

Structural/Functional domain family	Pfam acc.no./SCOP ID	Domain Region
Pribosyltran	PF00156	38-166

Mtb Structural Proteome models

Model Number	1
Model name	Rv3624c
Template	1YFZ APDB CREDO
Template coverage	5_180
Template Identity(%)	57.4
Model coverage(%)	83.4
Normalized DOPE score	-1.688

Model Number	2
Model name	Rv3624c.1
Template	1CJB APDB CREDO
Template coverage	9_224
Template Identity(%)	24.7
Model coverage(%)	98.6
Normalized DOPE score	-0.652

Structure Models from Chopin

Model Number	1
Profile	c.61.1.1 - 3.40.50.2020 Click for model details
zscore	13.21
Residue begin	1
Residue end	216

Binding pockets

STRING

Cytoscape Web will replace the contents of this div with protein-protein interaction network.

Protein interacting with Rv3624c	Gene name	Confidence Score
Rv0357c	purA	0.997
Rv3396c	guaA	0.995
Rv3396c	guaA	0.995
Rv3396c	guaA	0.995
Rv3625c	mesJ	0.994
Rv3625c	mesJ	0.994
Rv0733	adk	0.987
Rv2584c	apt	0.985
Rv0957	purH	0.983
Rv0957	purH	0.983
Rv3307	deoD	0.973
Rv1389	gmk	0.973
Rv3411c	guaB2	0.971
Rv3411c	guaB2	0.971
Rv0777	purB	0.955
Rv0777	purB	0.955
Rv1843c	guaB1	0.94
Rv1843c	guaB1	0.94
Rv3393	iunH	0.927
Rv1021	Rv1021	0.924
Rv3313c	add	0.918
Rv1617	pykA	0.914
Rv3609c	folE	0.914
Rv1617	pykA	0.914

Potential ligand/drug binding sites

Protein Model	Pocket Number	Drug Binding Site	PMIN Score	Pvalue PMIN	PMAX Score	Pvalue PMAX
Rv3624c.1	1	3rif_IVM_A_403 PDB CREDO	0.701	0.080	0.677	0.000
Rv3624c.1	1	1jg2_ADN_A_500 PDB CREDO	0.699	0.081	0.675	0.000
Rv3624c.1	1	3ri5_IVM_C_350 PDB CREDO	0.691	0.088	0.667	0.001
Rv3624c.1	1	3ria_IVM_C_349 PDB CREDO	0.690	0.088	0.666	0.001
Rv3624c.1	1	3rif_IVM_A_402 PDB CREDO	0.690	0.088	0.666	0.001
Rv3624c.1	1	3rif_IVM_D_402 PDB CREDO	0.688	0.090	0.664	0.001
Rv3624c.1	1	3rif_IVM_B_403 PDB CREDO	0.688	0.090	0.664	0.001
Rv3624c.1	1	1jg3_ADN_A_500 PDB CREDO	0.708	0.074	0.659	0.001
Rv3624c.1	18	1uay_ADN_A_1001 PDB CREDO	0.653	0.121	0.653	0.001
Rv3624c.1	1	3ria_IVM_E_349 PDB CREDO	0.745	0.050	0.643	0.001
Rv3624c.1	1	3rhw_IVM_A_348 PDB CREDO	0.744	0.051	0.642	0.001
Rv3624c.1	1	3ri5_IVM_A_349 PDB CREDO	0.737	0.055	0.637	0.001
Rv3624c.1	1	3ut5_LOC_D_502 PDB CREDO	0.797	0.026	0.631	0.001
Rv3624c.1	1	3e22_LOC_D_700 PDB CREDO	0.795	0.027	0.629	0.001
Rv3624c.1	1	3e22_LOC_B_700 PDB CREDO	0.788	0.029	0.624	0.001
Rv3624c.1	1	3rif_IVM_E_402 PDB CREDO	0.719	0.067	0.621	0.001
Rv3624c.1	1	3bbt_FMM_D_91 PDB CREDO	0.665	0.110	0.621	0.001
Rv3624c.1	1	2xpv_MIY_A_1209 PDB CREDO	0.620	0.156	0.620	0.001
Rv3624c.1	1	3rhw_IVM_D_348 PDB CREDO	0.718	0.067	0.620	0.001
Rv3624c.1	1	3rhw_IVM_B_349 PDB CREDO	0.718	0.068	0.620	0.001
Rv3624c.1	1	3ria_IVM_A_348 PDB CREDO	0.718	0.068	0.620	0.001
Rv3624c.1	1	3ria_IVM_C_350 PDB CREDO	0.718	0.068	0.620	0.001
Rv3624c.1	1	3ria_IVM_E_348 PDB CREDO	0.717	0.068	0.619	0.001
Rv3624c.1	1	3ri5_IVM_D_349 PDB CREDO	0.716	0.069	0.618	0.001
Rv3624c.1	1	3rhw_IVM_B_348 PDB CREDO	0.716	0.069	0.618	0.002
Rv3624c.1	1	3rhw_IVM_D_349 PDB CREDO	0.715	0.070	0.617	0.002
Rv3624c.1	1	3ri5_IVM_B_349 PDB CREDO	0.713	0.071	0.616	0.002
Rv3624c.1	1	3ut5_LOC_B_502 PDB CREDO	0.818	0.019	0.609	0.002
Rv3624c.1	1	1jg3_ADN_B_550 PDB CREDO	0.732	0.058	0.608	0.002
Rv3624c.1	1	1ie4_T44_B_328 PDB CREDO	0.724	0.064	0.602	0.002
Rv3624c.1	1	3oht_1N1_B_1000 PDB CREDO	0.602	0.177	0.602	0.002
Rv3624c.1	13	2w03_ADN_A_1588 PDB CREDO	0.597	0.182	0.597	0.002
Rv3624c.1	1	2ito_IRE_A_2020 PDB CREDO	0.689	0.089	0.595	0.002
Rv3624c.1	1	1sa1_POD_D_701 PDB CREDO	0.820	0.018	0.592	0.002
Rv3624c.1	1	3spk_TPV_A_100 PDB CREDO	0.655	0.120	0.590	0.003
Rv3624c.1	1	1sa1_POD_B_700 PDB CREDO	0.840	0.013	0.589	0.003
Rv3624c.1	1	3ri5_IVM_E_349 PDB CREDO	0.723	0.064	0.578	0.003
Rv3624c.1	18	2uxp_CLM_B_1211 PDB CREDO	0.577	0.207	0.577	0.003
Rv3624c.1	18	1r9o_FLP_A_501 PDB CREDO	0.576	0.209	0.576	0.003
Rv3624c.1	18	1sn0_T44_C_601 PDB CREDO	0.601	0.177	0.575	0.003
Rv3624c.1	1	1ya3_STR_B_2001 PDB CREDO	0.595	0.185	0.575	0.003
Rv3624c.1	18	3ads_IMN_B_3 PDB CREDO	0.656	0.118	0.574	0.003
Rv3624c.1	1	3q1e_T44_C_128 PDB CREDO	0.665	0.110	0.574	0.003
Rv3624c.1	18	4dta_ADN_A_401 PDB CREDO	0.600	0.178	0.574	0.003
Rv3624c.1	1	3oht_1N1_A_1000 PDB CREDO	0.639	0.136	0.573	0.003
Rv3624c.1	1	3bbt_FMM_B_91 PDB CREDO	0.662	0.113	0.571	0.004
Rv3624c.1	18	2uxp_CLM_A_1211 PDB CREDO	0.571	0.216	0.571	0.004
Rv3624c.1	1	1ict_T44_D_129 PDB CREDO	0.714	0.071	0.570	0.004
Rv3624c.1	1	1ict_T44_C_128 PDB CREDO	0.770	0.037	0.568	0.004
Rv3624c.1	1	1ya3_STR_A_1001 PDB CREDO	0.587	0.195	0.567	0.004
Rv3624c.1	18	3hm1_J3Z_A_2 PDB CREDO	0.566	0.223	0.566	0.004
Rv3624c.1	13	3s20_CER_A_1 PDB CREDO	0.623	0.152	0.562	0.004
Rv3624c.1	1	2ity_IRE_A_2020 PDB CREDO	0.701	0.080	0.560	0.004
Rv3624c.1	1	3f4x_KLT_A_300 PDB CREDO	0.649	0.126	0.560	0.004
Rv3624c.1	13	2oa1_ADN_B_2005 PDB CREDO	0.559	0.231	0.559	0.004
Rv3624c.1	14	4e3a_ADN_A_500 PDB CREDO	0.634	0.141	0.558	0.004
Rv3624c.1	13	1tz8_DES_B_128 PDB CREDO	0.589	0.193	0.558	0.004
Rv3624c.1	13	2xn3_ID8_A_1356 PDB CREDO	0.619	0.157	0.555	0.005
Rv3624c.1	1	2xkw_P1B_B_1475 PDB CREDO	0.575	0.211	0.555	0.005
Rv3624c.1	18	3ug2_IRE_A_1 PDB CREDO	0.639	0.135	0.554	0.005
Rv3624c.1	13	3ijx_HCZ_D_800 PDB CREDO	0.617	0.159	0.553	0.005
Rv3624c.1	1	2h42_VIA_A_901 PDB CREDO	0.590	0.191	0.551	0.005
Rv3624c.1	1	1mx1_THA_C_3 PDB CREDO	0.550	0.244	0.550	0.005
Rv3624c.1	18	1sn5_T3_D_602 PDB CREDO	0.575	0.210	0.549	0.005
Rv3624c.1	1	1hwi_115_A_2 PDB CREDO	0.628	0.147	0.548	0.005
Rv3624c.1	13	3ilt_TRU_E_800 PDB CREDO	0.639	0.136	0.548	0.005
Rv3624c.1	18	1xbb_STI_A_1 PDB CREDO	0.630	0.144	0.547	0.005
Rv3624c.1	1	1ie4_T44_A_128 PDB CREDO	0.741	0.053	0.546	0.005
Rv3624c.1	13	3rf4_FUN_A_201 PDB CREDO	0.606	0.172	0.546	0.005
Rv3624c.1	1	1lhu_EST_A_301 PDB CREDO	0.546	0.250	0.546	0.005
Rv3624c.1	1	1ya3_STR_C_3001 PDB CREDO	0.587	0.195	0.546	0.005
Rv3624c.1	13	3ik6_HCZ_B_262 PDB CREDO	0.575	0.211	0.545	0.005
Rv3624c.1	14	1bx4_ADN_A_350 PDB CREDO	0.545	0.251	0.545	0.005
Rv3624c.1	1	3jwq_VIA_D_901 PDB CREDO	0.583	0.200	0.544	0.006
Rv3624c.1	1	3h52_486_C_4 PDB CREDO	0.564	0.225	0.544	0.006
Rv3624c.1	1	2itz_IRE_A_2021 PDB CREDO	0.708	0.075	0.543	0.006
Rv3624c.1	1	1s9p_DES_A_459 PDB CREDO	0.543	0.254	0.543	0.006
Rv3624c.1	1	3adx_IMN_B_3 PDB CREDO	0.706	0.076	0.542	0.006
Rv3624c.1	1	1p93_DEX_A_1999 PDB CREDO	0.580	0.204	0.541	0.006
Rv3624c.1	13	2bxg_IBP_A_2001 PDB CREDO	0.541	0.257	0.541	0.006
Rv3624c.1	18	1qhy_CLM_A_999 PDB CREDO	0.623	0.152	0.540	0.006
Rv3624c.1	18	3r9c_ECL_A_452 PDB CREDO	0.644	0.131	0.540	0.006
Rv3624c.1	13	3hgx_SAL_A_102 PDB CREDO	0.569	0.218	0.539	0.006
Rv3624c.1	13	3ret_SAL_A_201 PDB CREDO	0.569	0.218	0.539	0.006
Rv3624c.1	13	3ads_IMN_A_1 PDB CREDO	0.568	0.220	0.538	0.006
Rv3624c.1	13	3rf4_FUN_C_203 PDB CREDO	0.596	0.184	0.537	0.006
Rv3624c.1	1	2aa6_STR_A_401 PDB CREDO	0.616	0.160	0.537	0.006
Rv3624c.1	1	3frq_ERY_B_195 PDB CREDO	0.678	0.099	0.537	0.006
Rv3624c.1	1	3ads_IMN_B_3 PDB CREDO	0.792	0.028	0.536	0.006
Rv3624c.1	13	3ik6_HCZ_B_800 PDB CREDO	0.595	0.186	0.536	0.006
Rv3624c.1	1	1lhv_NOG_A_301 PDB CREDO	0.655	0.120	0.535	0.006
Rv3624c.1	1	2aa5_STR_B_302 PDB CREDO	0.613	0.163	0.535	0.006
Rv3624c.1	18	2y7j_B49_A_1294 PDB CREDO	0.535	0.266	0.535	0.006
Rv3624c.1	13	3rf4_FUN_B_202 PDB CREDO	0.593	0.187	0.535	0.006
Rv3624c.1	18	3lfa_1N1_A_361 PDB CREDO	0.637	0.137	0.535	0.006
Rv3624c.1	1	1fm6_BRL_D_503 PDB CREDO	0.534	0.266	0.534	0.006
Rv3624c.1	1	2aax_PDN_A_502 PDB CREDO	0.613	0.164	0.534	0.006
Rv3624c.1	1	2q1v_PDN_A_248 PDB CREDO	0.552	0.241	0.533	0.007
Rv3624c.1	1	2aa6_STR_B_402 PDB CREDO	0.611	0.166	0.533	0.007
Rv3624c.1	1	1p93_DEX_B_2999 PDB CREDO	0.571	0.216	0.532	0.007
Rv3624c.1	14	3ndv_AIC_B_376 PDB CREDO	0.582	0.201	0.532	0.007
Rv3624c.1	1	2aa5_STR_A_301 PDB CREDO	0.610	0.167	0.532	0.007
Rv3624c.1	1	2aax_PDN_B_503 PDB CREDO	0.610	0.167	0.532	0.007
Rv3624c.1	14	3ndv_AIC_D_374 PDB CREDO	0.581	0.202	0.531	0.007
Rv3624c.1	18	1qku_EST_B_600 PDB CREDO	0.531	0.272	0.531	0.007
Rv3624c.1	14	2pkm_ADN_A_501 PDB CREDO	0.555	0.238	0.530	0.007
Rv3624c.1	1	2prg_BRL_A_1 PDB CREDO	0.530	0.273	0.530	0.007
Rv3624c.1	1	3tkd_CYZ_B_267 PDB CREDO	0.712	0.072	0.530	0.007
Rv3624c.1	18	1pcg_EST_B_2 PDB CREDO	0.530	0.273	0.530	0.007
Rv3624c.1	18	1qku_EST_C_600 PDB CREDO	0.530	0.273	0.530	0.007
Rv3624c.1	14	2c49_ADN_A_1301 PDB CREDO	0.678	0.098	0.529	0.007
Rv3624c.1	18	3grv_ADN_A_300 PDB CREDO	0.554	0.239	0.529	0.007
Rv3624c.1	18	1ere_EST_B_600 PDB CREDO	0.527	0.276	0.527	0.007
Rv3624c.1	1	1hwi_115_C_4 PDB CREDO	0.546	0.250	0.527	0.007
Rv3624c.1	18	1ere_EST_A_600 PDB CREDO	0.526	0.278	0.526	0.007
Rv3624c.1	18	1ere_EST_E_600 PDB CREDO	0.526	0.278	0.526	0.007
Rv3624c.1	18	1qku_EST_A_600 PDB CREDO	0.526	0.278	0.526	0.007
Rv3624c.1	13	3mg0_BO2_Y_1403 PDB CREDO	0.526	0.278	0.526	0.007
Rv3624c.1	1	3sxr_1N1_A_1 PDB CREDO	0.658	0.117	0.526	0.007
Rv3624c.1	18	1gwr_EST_A_600 PDB CREDO	0.525	0.280	0.525	0.007
Rv3624c.1	13	3mg0_BO2_K_1402 PDB CREDO	0.525	0.280	0.525	0.007
Rv3624c.1	13	3ijx_HCZ_B_800 PDB CREDO	0.582	0.201	0.524	0.008
Rv3624c.1	1	3jwq_VIA_B_901 PDB CREDO	0.543	0.254	0.524	0.008
Rv3624c.1	18	1gwr_EST_B_600 PDB CREDO	0.523	0.283	0.523	0.008
Rv3624c.1	14	3ny4_SMX_A_308 PDB CREDO	0.599	0.180	0.523	0.008
Rv3624c.1	14	3ubo_ADN_B_353 PDB CREDO	0.546	0.250	0.523	0.008
Rv3624c.1	1	2nni_MTK_A_501 PDB CREDO	0.768	0.038	0.523	0.008
Rv3624c.1	1	1a28_STR_A_1 PDB CREDO	0.523	0.284	0.523	0.008
Rv3624c.1	18	1sn5_T3_C_601 PDB CREDO	0.623	0.153	0.522	0.008
Rv3624c.1	1	2uxo_TAC_B_1211 PDB CREDO	0.680	0.097	0.522	0.008
Rv3624c.1	1	2ab2_SNL_A_502 PDB CREDO	0.659	0.116	0.522	0.008
Rv3624c.1	14	3ndv_AIC_C_375 PDB CREDO	0.597	0.183	0.521	0.008
Rv3624c.1	1	2ab2_SNL_B_503 PDB CREDO	0.657	0.117	0.520	0.008
Rv3624c.1	1	2vke_TAC_A_222 PDB CREDO	0.626	0.149	0.520	0.008
Rv3624c.1	18	2bxf_DZP_A_2001 PDB CREDO	0.519	0.289	0.519	0.008
Rv3624c.1	14	3ubo_ADN_A_353 PDB CREDO	0.542	0.255	0.519	0.008
Rv3624c.1	1	3tkd_CYZ_A_266 PDB CREDO	0.655	0.119	0.519	0.008
Rv3624c.1	1	1nhz_486_A_800 PDB CREDO	0.575	0.210	0.519	0.008
Rv3624c.1	1	2oax_SNL_B_2001 PDB CREDO	0.655	0.120	0.518	0.008
Rv3624c.1	18	1g50_EST_B_1600 PDB CREDO	0.518	0.291	0.518	0.008
Rv3624c.1	18	2bxf_DZP_B_2001 PDB CREDO	0.518	0.291	0.518	0.008
Rv3624c.1	14	3ndv_AIC_A_375 PDB CREDO	0.594	0.187	0.518	0.008
Rv3624c.1	1	3oct_1N1_A_663 PDB CREDO	0.536	0.263	0.518	0.008
Rv3624c.1	13	1lbc_CYZ_C_331 PDB CREDO	0.518	0.291	0.518	0.008
Rv3624c.1	13	1lik_ADN_A_799 PDB CREDO	0.612	0.165	0.518	0.008
Rv3624c.1	14	3m6b_1RG_A_308 PDB CREDO	0.517	0.292	0.517	0.008
Rv3624c.1	1	1zgy_BRL_A_503 PDB CREDO	0.573	0.213	0.516	0.009
Rv3624c.1	13	2f16_BO2_K_1402 PDB CREDO	0.516	0.293	0.516	0.009
Rv3624c.1	13	2f16_BO2_Y_1403 PDB CREDO	0.516	0.293	0.516	0.009
Rv3624c.1	13	3ret_SAL_B_201 PDB CREDO	0.545	0.251	0.516	0.009
Rv3624c.1	18	1ie4_T44_A_128 PDB CREDO	0.642	0.133	0.516	0.009
Rv3624c.1	1	1hwi_115_B_1 PDB CREDO	0.652	0.123	0.516	0.009
Rv3624c.1	1	3vhu_SNL_A_1001 PDB CREDO	0.652	0.123	0.516	0.009
Rv3624c.1	1	1oq5_CEL_A_701 PDB CREDO	0.534	0.266	0.516	0.009
Rv3624c.1	1	2xpw_OTC_A_222 PDB CREDO	0.621	0.155	0.516	0.009
Rv3624c.1	1	2oax_SNL_C_3001 PDB CREDO	0.651	0.123	0.515	0.009
Rv3624c.1	13	3r9c_ECL_A_451 PDB CREDO	0.542	0.255	0.514	0.009
Rv3624c.1	1	1p93_DEX_C_3999 PDB CREDO	0.609	0.168	0.514	0.009
Rv3624c.1	14	3ue0_AZR_A_998 PDB CREDO	0.589	0.192	0.514	0.009
Rv3624c.1	1	3h0a_9RA_A_500 PDB CREDO	0.551	0.243	0.514	0.009
Rv3624c.1	13	4dt8_ADN_B_401 PDB CREDO	0.514	0.297	0.514	0.009
Rv3624c.1	1	3mne_DEX_A_784 PDB CREDO	0.608	0.170	0.513	0.009
Rv3624c.1	18	2uxo_TAC_B_1211 PDB CREDO	0.664	0.111	0.513	0.009
Rv3624c.1	1	1hwi_115_D_3 PDB CREDO	0.647	0.127	0.512	0.009
Rv3624c.1	13	3hgx_SAL_B_104 PDB CREDO	0.541	0.257	0.512	0.009
Rv3624c.1	18	3uud_EST_B_600 PDB CREDO	0.663	0.112	0.512	0.009
Rv3624c.1	18	3s20_CER_B_1 PDB CREDO	0.562	0.227	0.512	0.009
Rv3624c.1	1	2h77_T3_A_1 PDB CREDO	0.567	0.221	0.511	0.009
Rv3624c.1	1	3gn8_DEX_B_247 PDB CREDO	0.605	0.173	0.510	0.009
Rv3624c.1	1	2h42_VIA_C_903 PDB CREDO	0.529	0.275	0.510	0.009
Rv3624c.1	13	3ug2_IRE_A_1 PDB CREDO	0.595	0.186	0.510	0.009
Rv3624c.1	1	3k54_1N1_A_1 PDB CREDO	0.547	0.248	0.509	0.009
Rv3624c.1	1	1m2z_DEX_D_401 PDB CREDO	0.603	0.175	0.509	0.009
Rv3624c.1	13	1e7a_PFL_A_4001 PDB CREDO	0.509	0.304	0.509	0.009
Rv3624c.1	1	1m2z_DEX_A_301 PDB CREDO	0.603	0.176	0.509	0.010
Rv3624c.1	1	1p93_DEX_D_4999 PDB CREDO	0.603	0.176	0.509	0.010
Rv3624c.1	18	2yja_EST_B_1550 PDB CREDO	0.658	0.117	0.508	0.010
Rv3624c.1	18	3ols_EST_B_600 PDB CREDO	0.658	0.117	0.508	0.010
Rv3624c.1	1	3gn8_DEX_A_247 PDB CREDO	0.602	0.177	0.508	0.010
Rv3624c.1	18	1g50_EST_A_600 PDB CREDO	0.656	0.118	0.507	0.010
Rv3624c.1	1	2h42_VIA_B_902 PDB CREDO	0.525	0.281	0.506	0.010
Rv3624c.1	1	3qt0_486_A_4 PDB CREDO	0.543	0.254	0.506	0.010
Rv3624c.1	18	3uud_EST_A_600 PDB CREDO	0.655	0.119	0.506	0.010
Rv3624c.1	13	3ilt_TRU_B_800 PDB CREDO	0.533	0.268	0.506	0.010
Rv3624c.1	18	2y7j_B49_D_1294 PDB CREDO	0.530	0.273	0.506	0.010
Rv3624c.1	1	2h79_T3_A_1 PDB CREDO	0.580	0.204	0.505	0.010
Rv3624c.1	18	3ads_IMN_A_1 PDB CREDO	0.645	0.129	0.505	0.010
Rv3624c.1	13	3rem_SAL_A_301 PDB CREDO	0.560	0.230	0.505	0.010
Rv3624c.1	18	2itz_IRE_A_2021 PDB CREDO	0.653	0.121	0.504	0.010
Rv3624c.1	1	3sxr_1N1_B_2 PDB CREDO	0.657	0.118	0.504	0.010
Rv3624c.1	18	3adx_IMN_B_3 PDB CREDO	0.652	0.122	0.504	0.010
Rv3624c.1	18	4dt8_ADN_A_401 PDB CREDO	0.526	0.278	0.503	0.010
Rv3624c.1	18	3ols_EST_A_600 PDB CREDO	0.651	0.123	0.503	0.010
Rv3624c.1	18	1sn0_T44_B_602 PDB CREDO	0.641	0.133	0.502	0.011
Rv3624c.1	13	3s20_CER_B_1 PDB CREDO	0.615	0.162	0.502	0.011
Rv3624c.1	14	3ue0_AZR_B_999 PDB CREDO	0.569	0.218	0.501	0.011
Rv3624c.1	13	1rj6_AZM_B_401 PDB CREDO	0.501	0.317	0.501	0.011
Rv3624c.1	13	1lbc_CYZ_A_330 PDB CREDO	0.528	0.276	0.501	0.011
Rv3624c.1	13	1sn0_T44_B_602 PDB CREDO	0.528	0.276	0.501	0.011
Rv3624c.1	1	3h52_486_D_2 PDB CREDO	0.672	0.104	0.500	0.011

Similarity to known drug target from sensitive sequence analysis

No drug targets

List of small molecules tested from TIBLE

Data not available

Off-target activity - ligand based from TIBLE

Data not available

Small molecules involved in protein-protein complex from TIMBAL .Proteins similar to Mtb based on sequence analysis.

Data not available

STITCH interactions

Chemical Name	Confidence score	Molecular Weight
guanylatePubChem	0.992	363.221
inosine monophosphatePubChem	0.989	348.206
hypoxanthinePubChem	0.986	136.111
magnesiumPubChem	0.98	24.305
pyrophosphatePubChem	0.979	177.975
guaninePubChem	0.978	151.126
phosphoribosylpyrophosphatePubChem	0.968	390.07
inosinePubChem	0.953	268.226
ribose 1-phosphatePubChem	0.937	230.11
xanthosine monophosphatePubChem	0.936	364.205
phosphatePubChem	0.934	96.9872
SODIUM XANTHINEPubChem	0.9	152.111
xanthosine 5'-phosphatePubChem	0.9	364.205
nucleoside monophosphatePubChem	0.78	214.11
calciumPubChem	0.777	40.078
acetatePubChem	0.722	59.044
adeninePubChem	0.712	135.127
6-thioguaninePubChem	0.709	167.192
hydride acetatePubChem	0.707	61.0599
dioxanePubChem	0.707	88.1051