SInCRe - Rv2124c

Tuberculist information

Gene name	metH
Protein function	5-methyltetrahydrofolate--homocystein methyltransferase MetH (methionine synthase, vitamin-B12 dependent isozyme) (ms)
Functional category(tuberculist)	intermediary metabolism and respiration
Gene location(kb)	2382.49
Molecular mass(da)	130291
External sites	TB Database TubercuList WebTB

Protein sequence

Number of amino acids : 1192

	  		  	1    VTAADKHLYDTDLLDVLSQRVMVGDGAMGTQLQAADLTLDDFRGLEGCNEILNETRPDVL   60
			  	61   ETIHRNYFEAGADAVETNTFGCNLSNLGDYDIADRIRDLSQKGTAIARRVADELGSPDRK  120
			  	121  RYVLGSMGPGTKLPTLGHTEYAVIRDAYTEAALGMLDGGADAILVETCQDLLQLKAAVLG  180
			  	181  SRRAMTRAGRHIPVFAHVTVETTGTMLLGSEIGAALTAVEPLGVDMIGLNCATGPAEMSE  240
			  	241  HLRHLSRHARIPVSVMPNAGLPVLGAKGAEYPLLPDELAEALAGFIAEFGLSLVGGCCGT  300
			  	301  TPAHIREVAAAVANIKRPERQVSYEPSVSSLYTAIPFAQDASVLVIGERTNANGSKGFRE  360
			  	361  AMIAEDYQKCLDIAKDQTRDGAHLLDLCVDYVGRDGVADMKALASRLATSSTLPIMLDST  420
			  	421  ETAVLQAGLEHLGGRCAINSVNYEDGDGPESRFAKTMALVAEHGAAVVALTIDEEGQART  480
			  	481  AQKKVEIAERLINDITGNWGVDESSILIDTLTFTIATGQEESRRDGIETIEAIRELKKRH  540
			  	541  PDVQTTLGLSNISFGLNPAARQVLNSVFLHECQEAGLDSAIVHASKILPMNRIPEEQRNV  600
			  	601  ALDLVYDRRREDYDPLQELMRLFEGVSAASSKEDRLAELAGLPLFERLAQRIVDGERNGL  660
			  	661  DADLDEAMTQKPPLQIINEHLLAGMKTVGELFGSGQMQLPFVLQSAEVMKAAVAYLEPHM  720
			  	721  ERSDDDSGKGRIVLATVKGDVHDIGKNLVDIILSNNGYEVVNIGIKQPIATILEVAEDKS  780
			  	781  ADVVGMSGLLVKSTVVMKENLEEMNTRGVAEKFPVLLGGAALTRSYVENDLAEIYQGEVH  840
			  	841  YARDAFEGLKLMDTIMSAKRGEAPDENSPEAIKAREKEAERKARHQRSKRIAAQRKAAEE  900
			  	901  PVEVPERSDVAADIEVPAPPFWGSRIVKGLAVADYTGLLDERALFLGQWGLRGQRGGEGP  960
			  	961  SYEDLVETEGRPRLRYWLDRLSTDGILAHAAVVYGYFPAVSEGNDIVVLTEPKPDAPVRY 1020
			  	1021 RFHFPRQQRGRFLCIADFIRSRELAAERGEVDVLPFQLVTMGQPIADFANELFASNAYRD 1080
			  	1081 YLEVHGIGVQLTEALAEYWHRRIREELKFSGDRAMAAEDPEAKEDYFKLGYRGARFAFGY 1140
			  	1141 GACPDLEDRAKMMALLEPERIGVTLSEELQLHPEQSTDAFVLHHPEAKYFNV

Known structures in the PDB

No Known structures

Number of amino acids : 1192

Domains assigned based on sequence.

Mtb Structural proteome models

CHOPIN models

Profile-based domain assignment

Structural/Functional domain family	Pfam acc.no./SCOP ID	Domain Region
S-methyl_trans	PF02574	21-314
Pterin_bind	PF00809	343-555
B12-binding_2	PF02607	642-718
B12-binding	PF02310	730-850
Met_synt_B12	PF02965	941-1192

Mtb Structural Proteome models

Model Number	1
Model name	Rv2124c.2
Template	1F6Y APDB CREDO
Template coverage	1_261
Template Identity(%)	29.2
Model coverage(%)	22.8
Normalized DOPE score	-0.987

Model Number	2
Model name	Rv2124c.1
Template	1Q7Z APDB CREDO
Template coverage	5_553
Template Identity(%)	30.1
Model coverage(%)	49.2
Normalized DOPE score	-0.536

Model Number	3
Model name	Rv2124c
Template	1K7Y APDB CREDO
Template coverage	652_1192
Template Identity(%)	32.9
Model coverage(%)	46.6
Normalized DOPE score	0.078

Model Number	4
Model name	Rv2124c.3
Template	1REQ APDB CREDO
Template coverage	416_728
Template Identity(%)	15.2
Model coverage(%)	25.9
Normalized DOPE score	0.971

Structure Models from Chopin

Model Number	1
Profile	c.1.21.2, c.1.26.1 - 3.20.20.20, 3.20.20.330 Click for model details
zscore	74.53
Residue begin	7
Residue end	605

Model Number	2
Profile	1.10.1240.10, 1.10.288.10, 3.10.196.10, 3.40.50.280 Click for model details
zscore	67.48
Residue begin	636
Residue end	1192

Model Number	3
Profile	3.20.20.330 Click for model details
zscore	61.48
Residue begin	7
Residue end	325

Model Number	4
Profile	c.1.21.2 - 3.20.20.20 Click for model details
zscore	47.84
Residue begin	328
Residue end	617

Model Number	5
Profile	a.46.1.1, c.23.6.1 - 1.10.1240.10, 3.40.50.280 Click for model details
zscore	46.78
Residue begin	636
Residue end	881

Model Number	6
Profile	d.173.1.1 Click for model details
zscore	29.77
Residue begin	894
Residue end	1192

Model Number	7
Profile	c.23.6.1 - 3.40.50.280 Click for model details
zscore	27.76
Residue begin	726
Residue end	862

Model Number	8
Profile	c.23.6.1 Click for model details
zscore	24.38
Residue begin	694
Residue end	881

Model Number	9
Profile	1.10.1240.10 Click for model details
zscore	24.21
Residue begin	636
Residue end	721

Binding pockets

STRING

Cytoscape Web will replace the contents of this div with protein-protein interaction network.

Protein interacting with Rv2124c	Gene name	Confidence Score
Rv1392	metK	0.996
Rv1392	metK	0.996
Rv1392	metK	0.996
Rv1133c	metE	0.992
Rv1133c	metE	0.992
Rv3248c	sahH	0.991
Rv3248c	sahH	0.991
Rv1079	metB	0.982
Rv3340	metC	0.972
Rv0070c	glyA2	0.964
Rv1093	glyA1	0.964
Rv1077	cbs	0.961
Rv1077	cbs	0.961
Rv2964	purU	0.959
Rv2964	purU	0.959
Rv1406	fmt	0.959
Rv1406	fmt	0.959
Rv2763c	dfrA	0.952
Rv0391	metZ	0.95
Rv1294	thrA	0.944
Rv1294	thrA	0.944
Rv1294	thrA	0.944
Rv2211c	gcvT	0.94
Rv2211c	gcvT	0.94
Rv1007c	metS	0.935
Rv0957	purH	0.931
Rv0957	purH	0.931
Rv0956	purN	0.91
Rv0075	Rv0075	0.904

Potential ligand/drug binding sites

Protein Model	Pocket Number	Drug Binding Site	PMIN Score	Pvalue PMIN	PMAX Score	Pvalue PMAX
Rv2124c.3	3	2jfa_RAL_B_600 PDB CREDO	0.687	0.091	0.687	0.000
Rv2124c.3	3	1err_RAL_A_600 PDB CREDO	0.681	0.096	0.681	0.000
Rv2124c.3	3	1err_RAL_B_600 PDB CREDO	0.675	0.101	0.675	0.000
Rv2124c.3	3	2jfa_RAL_A_600 PDB CREDO	0.691	0.087	0.670	0.001
Rv2124c.3	3	1qkn_RAL_A_600 PDB CREDO	0.712	0.072	0.648	0.001
Rv2124c.3	3	3h52_486_B_1 PDB CREDO	0.683	0.094	0.643	0.001
Rv2124c.3	3	3h52_486_D_2 PDB CREDO	0.660	0.115	0.640	0.001
Rv2124c.3	3	3h52_486_A_3 PDB CREDO	0.657	0.118	0.637	0.001
Rv2124c.3	3	3heg_BAX_A_1 PDB CREDO	0.676	0.100	0.636	0.001
Rv2124c.3	3	1xzx_T3_X_500 PDB CREDO	0.667	0.108	0.626	0.001
Rv2124c.3	3	2w8y_486_A_1000 PDB CREDO	0.682	0.095	0.623	0.001
Rv2124c.3	3	3uvv_T3_A_501 PDB CREDO	0.661	0.114	0.621	0.001
Rv2124c.1	30	3uq6_ADN_B_401 PDB CREDO	0.680	0.097	0.618	0.001
Rv2124c.3	3	1uwh_BAX_B_1723 PDB CREDO	0.637	0.138	0.618	0.002
Rv2124c.1	30	3uq6_ADN_A_401 PDB CREDO	0.679	0.098	0.617	0.002
Rv2124c.3	3	1uwh_BAX_A_1723 PDB CREDO	0.636	0.139	0.617	0.002
Rv2124c.3	3	4asd_BAX_A_1500 PDB CREDO	0.675	0.101	0.617	0.002
Rv2124c.3	3	1y0x_T44_X_500 PDB CREDO	0.636	0.139	0.616	0.002
Rv2124c.1	30	2nnj_225_A_501 PDB CREDO	0.615	0.162	0.615	0.002
Rv2124c.3	3	2oiq_STI_A_1001 PDB CREDO	0.653	0.122	0.614	0.002
Rv2124c.3	3	2pl0_STI_A_200 PDB CREDO	0.653	0.122	0.614	0.002
Rv2124c.3	3	1bsx_T3_A_1 PDB CREDO	0.675	0.101	0.614	0.002
Rv2124c.3	3	1bsx_T3_B_2 PDB CREDO	0.675	0.101	0.614	0.002
Rv2124c.3	3	3gws_T3_X_500 PDB CREDO	0.670	0.106	0.609	0.002
Rv2124c.3	3	3bbt_FMM_D_91 PDB CREDO	0.738	0.055	0.607	0.002
Rv2124c.3	3	1a28_STR_B_2 PDB CREDO	0.645	0.129	0.606	0.002
Rv2124c.3	3	2qxs_RAL_A_600 PDB CREDO	0.787	0.030	0.606	0.002
Rv2124c.3	3	3oez_STI_B_601 PDB CREDO	0.622	0.154	0.602	0.002
Rv2124c.3	3	2qxs_RAL_B_600 PDB CREDO	0.782	0.032	0.602	0.002
Rv2124c.3	3	3gcs_BAX_A_401 PDB CREDO	0.657	0.117	0.600	0.002
Rv2124c.3	3	1s9p_DES_A_459 PDB CREDO	0.779	0.033	0.598	0.002
Rv2124c.3	3	2hyy_STI_B_600 PDB CREDO	0.633	0.142	0.595	0.002
Rv2124c.3	3	2hw2_RFP_A_1200 PDB CREDO	0.613	0.164	0.594	0.002
Rv2124c.3	3	3oht_1N1_B_1000 PDB CREDO	0.773	0.036	0.593	0.002
Rv2124c.3	3	1uwj_BAX_B_1723 PDB CREDO	0.649	0.126	0.592	0.002
Rv2124c.1	30	2bdm_TMI_A_502 PDB CREDO	0.591	0.189	0.591	0.002
Rv2124c.3	3	1s9p_DES_D_600 PDB CREDO	0.770	0.037	0.591	0.002
Rv2124c.3	3	2y6o_1N1_A_1892 PDB CREDO	0.629	0.146	0.591	0.002
Rv2124c.3	3	1nhz_486_A_800 PDB CREDO	0.689	0.089	0.587	0.003
Rv2124c.3	3	3spk_TPV_B_100 PDB CREDO	0.660	0.115	0.585	0.003
Rv2124c.3	3	3erd_DES_A_600 PDB CREDO	0.789	0.029	0.584	0.003
Rv2124c.3	3	3mnp_DEX_A_784 PDB CREDO	0.582	0.201	0.582	0.003
Rv2124c.3	3	3h0a_9RA_A_500 PDB CREDO	0.707	0.076	0.581	0.003
Rv2124c.3	3	3mno_DEX_A_784 PDB CREDO	0.579	0.205	0.579	0.003
Rv2124c.3	3	3spk_TPV_A_100 PDB CREDO	0.680	0.097	0.578	0.003
Rv2124c.3	3	2h79_T3_A_1 PDB CREDO	0.657	0.118	0.578	0.003
Rv2124c.1	30	3mdt_VOR_A_506 PDB CREDO	0.673	0.103	0.577	0.003
Rv2124c.1	30	3mdt_VOR_B_506 PDB CREDO	0.673	0.103	0.577	0.003
Rv2124c.3	3	3erd_DES_B_800 PDB CREDO	0.779	0.034	0.576	0.003
Rv2124c.3	3	1fm6_BRL_X_504 PDB CREDO	0.613	0.163	0.576	0.003
Rv2124c.1	30	2eva_ADN_A_498 PDB CREDO	0.576	0.209	0.576	0.003
Rv2124c.3	3	1mx1_THA_C_3 PDB CREDO	0.750	0.048	0.575	0.003
Rv2124c.3	3	2oax_SNL_F_6001 PDB CREDO	0.612	0.165	0.575	0.003
Rv2124c.3	3	2oax_SNL_E_5001 PDB CREDO	0.610	0.168	0.573	0.003
Rv2124c.3	3	2oax_SNL_A_1001 PDB CREDO	0.609	0.168	0.573	0.003
Rv2124c.3	3	2oax_SNL_D_4001 PDB CREDO	0.609	0.168	0.573	0.003
Rv2124c.3	3	3cs9_NIL_A_600 PDB CREDO	0.722	0.065	0.571	0.004
Rv2124c.3	3	3so9_017_A_100 PDB CREDO	0.589	0.192	0.571	0.004
Rv2124c.1	30	3mdv_CL6_B_506 PDB CREDO	0.571	0.216	0.571	0.004
Rv2124c.3	3	2ab2_SNL_A_502 PDB CREDO	0.589	0.193	0.571	0.004
Rv2124c.3	3	2h77_T3_A_1 PDB CREDO	0.671	0.105	0.571	0.004
Rv2124c.3	3	1uwj_BAX_A_1723 PDB CREDO	0.682	0.095	0.571	0.004
Rv2124c.3	3	3hec_STI_A_1 PDB CREDO	0.588	0.194	0.570	0.004
Rv2124c.3	3	2ab2_SNL_B_503 PDB CREDO	0.587	0.195	0.569	0.004
Rv2124c.3	3	3vhu_SNL_A_1001 PDB CREDO	0.587	0.195	0.569	0.004
Rv2124c.3	3	2oax_SNL_B_2001 PDB CREDO	0.585	0.197	0.567	0.004
Rv2124c.3	3	2aa6_STR_A_401 PDB CREDO	0.644	0.131	0.566	0.004
Rv2124c.3	3	2aa6_STR_B_402 PDB CREDO	0.643	0.131	0.566	0.004
Rv2124c.1	30	3r9c_ECL_A_451 PDB CREDO	0.626	0.149	0.566	0.004
Rv2124c.3	3	2aax_PDN_A_502 PDB CREDO	0.643	0.132	0.565	0.004
Rv2124c.3	3	2aax_PDN_B_503 PDB CREDO	0.643	0.132	0.565	0.004
Rv2124c.3	3	3mne_DEX_A_784 PDB CREDO	0.622	0.154	0.565	0.004
Rv2124c.1	30	3ay0_ADN_A_401 PDB CREDO	0.565	0.224	0.565	0.004
Rv2124c.3	3	1sa1_POD_D_701 PDB CREDO	0.600	0.179	0.564	0.004
Rv2124c.3	3	3e22_LOC_B_700 PDB CREDO	0.582	0.201	0.564	0.004
Rv2124c.3	3	2fum_MIX_D_3539 PDB CREDO	0.686	0.092	0.564	0.004
Rv2124c.3	3	2oax_SNL_C_3001 PDB CREDO	0.582	0.201	0.564	0.004
Rv2124c.3	3	1p93_DEX_C_3999 PDB CREDO	0.619	0.157	0.563	0.004
Rv2124c.3	3	3jwq_VIA_D_901 PDB CREDO	0.684	0.093	0.563	0.004
Rv2124c.3	3	1m2z_DEX_A_301 PDB CREDO	0.619	0.157	0.562	0.004
Rv2124c.3	3	1p93_DEX_D_4999 PDB CREDO	0.619	0.157	0.562	0.004
Rv2124c.3	3	3e22_LOC_D_700 PDB CREDO	0.580	0.203	0.562	0.004
Rv2124c.1	30	3mdv_CL6_A_506 PDB CREDO	0.649	0.126	0.562	0.004
Rv2124c.3	3	3oez_STI_A_601 PDB CREDO	0.652	0.123	0.561	0.004
Rv2124c.1	30	3ay0_ADN_B_402 PDB CREDO	0.561	0.229	0.561	0.004
Rv2124c.3	3	1lhv_NOG_A_301 PDB CREDO	0.597	0.183	0.560	0.004
Rv2124c.1	30	3vkx_T3_A_301 PDB CREDO	0.588	0.194	0.560	0.004
Rv2124c.1	30	3jw5_TOP_A_208 PDB CREDO	0.619	0.156	0.560	0.004
Rv2124c.3	3	1sa1_POD_B_700 PDB CREDO	0.613	0.164	0.560	0.004
Rv2124c.3	3	3cs9_NIL_B_600 PDB CREDO	0.726	0.062	0.559	0.004
Rv2124c.3	3	3b0w_DGX_A_1 PDB CREDO	0.613	0.164	0.559	0.004
Rv2124c.3	3	3tne_RIT_A_401 PDB CREDO	0.577	0.208	0.559	0.004
Rv2124c.3	3	3pyy_STI_A_3 PDB CREDO	0.649	0.125	0.559	0.004
Rv2124c.3	3	3pyy_STI_B_4 PDB CREDO	0.649	0.125	0.559	0.004
Rv2124c.3	3	3b0w_DGX_B_1 PDB CREDO	0.686	0.092	0.558	0.004
Rv2124c.3	3	2hyy_STI_A_600 PDB CREDO	0.648	0.126	0.558	0.004
Rv2124c.3	3	1m2z_DEX_D_401 PDB CREDO	0.614	0.163	0.558	0.004
Rv2124c.3	3	3gn8_DEX_B_247 PDB CREDO	0.614	0.163	0.558	0.004
Rv2124c.1	23	2nni_MTK_A_501 PDB CREDO	0.740	0.054	0.558	0.004
Rv2124c.3	3	3vn2_TLS_A_501 PDB CREDO	0.558	0.233	0.558	0.004
Rv2124c.3	3	2hyy_STI_D_600 PDB CREDO	0.647	0.127	0.557	0.004
Rv2124c.3	3	1t7j_478_A_200 PDB CREDO	0.575	0.211	0.557	0.004
Rv2124c.1	23	3ria_IVM_C_349 PDB CREDO	0.640	0.134	0.557	0.004
Rv2124c.1	23	3rif_IVM_A_403 PDB CREDO	0.640	0.134	0.557	0.004
Rv2124c.1	23	3rif_IVM_B_403 PDB CREDO	0.640	0.134	0.557	0.004
Rv2124c.1	23	3rif_IVM_D_402 PDB CREDO	0.640	0.134	0.557	0.004
Rv2124c.3	3	3ms9_STI_A_1 PDB CREDO	0.646	0.128	0.557	0.004
Rv2124c.3	3	3gn8_DEX_A_247 PDB CREDO	0.612	0.165	0.556	0.005
Rv2124c.1	9	2oa1_ADN_B_2005 PDB CREDO	0.556	0.235	0.556	0.005
Rv2124c.1	23	3ri5_IVM_C_350 PDB CREDO	0.639	0.136	0.556	0.005
Rv2124c.3	3	1zgy_BRL_A_503 PDB CREDO	0.653	0.121	0.556	0.005
Rv2124c.1	23	3rif_IVM_A_402 PDB CREDO	0.638	0.136	0.555	0.005
Rv2124c.1	30	2bxf_DZP_B_2001 PDB CREDO	0.640	0.134	0.555	0.005
Rv2124c.3	3	2h42_VIA_A_901 PDB CREDO	0.674	0.102	0.555	0.005
Rv2124c.3	3	1n49_RIT_D_401 PDB CREDO	0.644	0.131	0.554	0.005
Rv2124c.3	3	3ms9_STI_B_1 PDB CREDO	0.644	0.131	0.554	0.005
Rv2124c.3	3	3mss_STI_A_1 PDB CREDO	0.644	0.131	0.554	0.005
Rv2124c.3	3	1z2b_VLB_C_800 PDB CREDO	0.589	0.192	0.554	0.005
Rv2124c.3	3	3mss_STI_C_1 PDB CREDO	0.643	0.131	0.554	0.005
Rv2124c.1	30	2bxf_DZP_A_2001 PDB CREDO	0.639	0.135	0.554	0.005
Rv2124c.3	3	3gvu_STI_A_1001 PDB CREDO	0.643	0.132	0.554	0.005
Rv2124c.3	3	3k5v_STI_B_2 PDB CREDO	0.643	0.132	0.554	0.005
Rv2124c.1	14	3tne_RIT_B_401 PDB CREDO	0.571	0.215	0.554	0.005
Rv2124c.3	3	2q1v_PDN_A_248 PDB CREDO	0.696	0.084	0.553	0.005
Rv2124c.3	3	2hyy_STI_C_600 PDB CREDO	0.642	0.132	0.553	0.005
Rv2124c.3	3	3mss_STI_D_1 PDB CREDO	0.642	0.132	0.553	0.005
Rv2124c.1	23	3ut5_LOC_D_502 PDB CREDO	0.630	0.145	0.553	0.005
Rv2124c.3	3	3mss_STI_B_1 PDB CREDO	0.642	0.133	0.553	0.005
Rv2124c.1	30	3jw5_TOP_B_208 PDB CREDO	0.611	0.166	0.552	0.005
Rv2124c.3	3	1iep_STI_A_201 PDB CREDO	0.641	0.133	0.552	0.005
Rv2124c.3	3	2x9g_LYA_A_1270 PDB CREDO	0.588	0.194	0.552	0.005
Rv2124c.3	3	1mx1_THA_E_5 PDB CREDO	0.772	0.037	0.551	0.005
Rv2124c.3	3	1iep_STI_B_202 PDB CREDO	0.639	0.136	0.550	0.005
Rv2124c.1	14	3tne_RIT_A_401 PDB CREDO	0.567	0.220	0.550	0.005
Rv2124c.1	14	1hwi_115_B_1 PDB CREDO	0.567	0.221	0.549	0.005
Rv2124c.1	14	1hwi_115_D_3 PDB CREDO	0.566	0.222	0.549	0.005
Rv2124c.3	3	1ya3_STR_A_1001 PDB CREDO	0.689	0.089	0.548	0.005
Rv2124c.1	14	1hwi_115_A_2 PDB CREDO	0.584	0.199	0.547	0.005
Rv2124c.1	30	1xbb_STI_A_1 PDB CREDO	0.546	0.249	0.546	0.005
Rv2124c.3	3	1opj_STI_A_3 PDB CREDO	0.688	0.091	0.544	0.006
Rv2124c.1	14	1hwk_117_D_3 PDB CREDO	0.598	0.182	0.544	0.006
Rv2124c.3	3	1opj_STI_B_4 PDB CREDO	0.687	0.091	0.544	0.006
Rv2124c.3	3	3oct_1N1_A_663 PDB CREDO	0.684	0.093	0.544	0.006
Rv2124c.1	14	1hwl_FBI_D_3 PDB CREDO	0.615	0.161	0.544	0.006
Rv2124c.1	14	1hwl_FBI_B_1 PDB CREDO	0.614	0.162	0.543	0.006
Rv2124c.3	3	3ln1_CEL_C_682 PDB CREDO	0.597	0.183	0.542	0.006
Rv2124c.3	3	3ln1_CEL_A_682 PDB CREDO	0.596	0.184	0.542	0.006
Rv2124c.1	30	3clb_TMQ_C_613 PDB CREDO	0.596	0.183	0.542	0.006
Rv2124c.1	30	3hbb_TMQ_A_611 PDB CREDO	0.596	0.183	0.542	0.006
Rv2124c.1	30	3ug2_IRE_A_1 PDB CREDO	0.541	0.256	0.541	0.006
Rv2124c.3	3	1gs4_ZK5_A_1918 PDB CREDO	0.731	0.059	0.541	0.006
Rv2124c.3	3	1jg2_ADN_A_500 PDB CREDO	0.681	0.096	0.541	0.006
Rv2124c.3	3	3ln1_CEL_B_682 PDB CREDO	0.595	0.185	0.541	0.006
Rv2124c.1	23	3ut5_LOC_B_502 PDB CREDO	0.655	0.119	0.541	0.006
Rv2124c.1	23	3gy3_PNT_A_246 PDB CREDO	0.600	0.179	0.541	0.006
Rv2124c.3	3	1t46_STI_A_3 PDB CREDO	0.740	0.053	0.540	0.006
Rv2124c.1	30	2w9s_TOP_E_1160 PDB CREDO	0.568	0.219	0.540	0.006
Rv2124c.3	3	3v5w_8PR_A_701 PDB CREDO	0.594	0.186	0.540	0.006
Rv2124c.3	3	3ogp_017_A_200 PDB CREDO	0.574	0.212	0.540	0.006
Rv2124c.3	3	3k5v_STI_A_2 PDB CREDO	0.662	0.112	0.539	0.006
Rv2124c.3	3	1ya3_STR_B_2001 PDB CREDO	0.677	0.100	0.538	0.006
Rv2124c.1	23	3ria_IVM_E_349 PDB CREDO	0.691	0.088	0.538	0.006
Rv2124c.1	14	1hwl_FBI_C_4 PDB CREDO	0.609	0.169	0.538	0.006
Rv2124c.1	30	2jap_J01_A_1249 PDB CREDO	0.565	0.224	0.538	0.006
Rv2124c.3	3	1sqn_NDR_B_2001 PDB CREDO	0.701	0.080	0.537	0.006
Rv2124c.1	30	3grv_ADN_A_300 PDB CREDO	0.591	0.189	0.537	0.006
Rv2124c.3	3	1sqn_NDR_A_1001 PDB CREDO	0.700	0.081	0.537	0.006
Rv2124c.3	3	3frq_ERY_B_195 PDB CREDO	0.554	0.238	0.537	0.006
Rv2124c.1	14	1hwl_FBI_A_2 PDB CREDO	0.608	0.170	0.537	0.006
Rv2124c.1	23	3ria_IVM_C_350 PDB CREDO	0.689	0.089	0.537	0.006
Rv2124c.1	14	1lhv_NOG_A_301 PDB CREDO	0.537	0.263	0.537	0.006
Rv2124c.3	3	3d91_REM_A_350 PDB CREDO	0.588	0.194	0.536	0.006
Rv2124c.1	23	3rhw_IVM_A_348 PDB CREDO	0.689	0.090	0.536	0.006
Rv2124c.1	23	3rhw_IVM_B_349 PDB CREDO	0.689	0.090	0.536	0.006
Rv2124c.1	23	3ria_IVM_E_348 PDB CREDO	0.689	0.090	0.536	0.006
Rv2124c.1	23	3ria_IVM_A_348 PDB CREDO	0.688	0.090	0.536	0.006
Rv2124c.1	23	3rhw_IVM_D_348 PDB CREDO	0.687	0.091	0.535	0.006
Rv2124c.1	23	3rhw_IVM_B_348 PDB CREDO	0.687	0.091	0.534	0.006
Rv2124c.1	23	3rhw_IVM_D_349 PDB CREDO	0.687	0.091	0.534	0.006
Rv2124c.1	23	3ri5_IVM_D_349 PDB CREDO	0.686	0.092	0.534	0.006
Rv2124c.1	23	3rif_IVM_E_402 PDB CREDO	0.686	0.092	0.534	0.006
Rv2124c.3	3	3cs9_NIL_C_600 PDB CREDO	0.731	0.059	0.534	0.007
Rv2124c.3	3	3d90_NOG_B_2001 PDB CREDO	0.627	0.148	0.534	0.007
Rv2124c.3	3	3h52_486_C_4 PDB CREDO	0.721	0.066	0.534	0.007
Rv2124c.1	23	3ri5_IVM_B_349 PDB CREDO	0.685	0.093	0.533	0.007
Rv2124c.3	3	3oht_1N1_A_1000 PDB CREDO	0.775	0.035	0.533	0.007
Rv2124c.1	23	3ri5_IVM_A_349 PDB CREDO	0.684	0.093	0.533	0.007
Rv2124c.3	3	1xkk_FMM_A_91 PDB CREDO	0.769	0.038	0.532	0.007
Rv2124c.3	3	3tkd_CYZ_B_267 PDB CREDO	0.549	0.245	0.532	0.007
Rv2124c.1	14	3q70_RIT_A_2001 PDB CREDO	0.603	0.176	0.532	0.007
Rv2124c.3	3	3d90_NOG_A_1001 PDB CREDO	0.625	0.150	0.532	0.007
Rv2124c.3	3	3d91_REM_B_350 PDB CREDO	0.583	0.200	0.532	0.007
Rv2124c.3	3	3ln1_CEL_D_682 PDB CREDO	0.646	0.128	0.532	0.007
Rv2124c.1	30	2jap_J01_C_1249 PDB CREDO	0.557	0.234	0.531	0.007
Rv2124c.3	3	3cs9_NIL_D_600 PDB CREDO	0.727	0.062	0.531	0.007
Rv2124c.1	30	1qhs_CLM_A_999 PDB CREDO	0.530	0.272	0.530	0.007
Rv2124c.1	30	2w9g_TOP_A_1159 PDB CREDO	0.653	0.121	0.530	0.007
Rv2124c.1	30	2w9s_TOP_A_1160 PDB CREDO	0.586	0.197	0.529	0.007
Rv2124c.1	30	2jap_J01_B_1249 PDB CREDO	0.555	0.237	0.528	0.007
Rv2124c.1	30	2jap_J01_D_1249 PDB CREDO	0.555	0.237	0.528	0.007
Rv2124c.1	30	1qhy_CLM_A_999 PDB CREDO	0.528	0.276	0.528	0.007
Rv2124c.3	3	3gp0_NIL_A_1 PDB CREDO	0.743	0.052	0.528	0.007
Rv2124c.3	3	2x2n_X2N_B_1479 PDB CREDO	0.545	0.252	0.528	0.007
Rv2124c.1	30	2w9h_TOP_A_1160 PDB CREDO	0.609	0.169	0.527	0.007
Rv2124c.3	3	2gqg_1N1_B_502 PDB CREDO	0.599	0.180	0.527	0.007
Rv2124c.3	3	1uob_PNN_A_1311 PDB CREDO	0.561	0.229	0.527	0.007
Rv2124c.1	30	3fl9_TOP_A_200 PDB CREDO	0.583	0.200	0.527	0.007
Rv2124c.3	3	1p93_DEX_B_2999 PDB CREDO	0.640	0.134	0.526	0.007
Rv2124c.1	30	3fl9_TOP_G_200 PDB CREDO	0.582	0.202	0.526	0.007
Rv2124c.3	3	1p93_DEX_A_1999 PDB CREDO	0.639	0.136	0.525	0.007
Rv2124c.1	30	1lik_ADN_A_699 PDB CREDO	0.524	0.281	0.524	0.008
Rv2124c.1	9	2jih_097_A_1001 PDB CREDO	0.582	0.201	0.524	0.008
Rv2124c.3	3	2x2n_X2N_A_1480 PDB CREDO	0.541	0.257	0.524	0.008
Rv2124c.1	9	2fn1_SAL_A_506 PDB CREDO	0.523	0.282	0.523	0.008
Rv2124c.3	3	2aoh_FRD_C_305 PDB CREDO	0.556	0.235	0.523	0.008
Rv2124c.1	30	2w9s_TOP_C_1160 PDB CREDO	0.579	0.205	0.523	0.008
Rv2124c.1	30	3fl9_TOP_B_200 PDB CREDO	0.579	0.205	0.523	0.008
Rv2124c.3	3	2j7y_E3O_A_1454 PDB CREDO	0.790	0.029	0.523	0.008
Rv2124c.1	23	1lhv_NOG_A_301 PDB CREDO	0.577	0.208	0.523	0.008
Rv2124c.3	3	3k54_1N1_A_1 PDB CREDO	0.731	0.059	0.522	0.008
Rv2124c.3	3	3ut5_LOC_D_502 PDB CREDO	0.539	0.260	0.522	0.008
Rv2124c.1	9	2fn1_SAL_B_503 PDB CREDO	0.522	0.285	0.522	0.008
Rv2124c.3	3	2gqg_1N1_A_501 PDB CREDO	0.705	0.077	0.522	0.008
Rv2124c.3	3	3bbt_FMM_B_91 PDB CREDO	0.787	0.030	0.521	0.008
Rv2124c.3	3	2aa5_STR_B_302 PDB CREDO	0.592	0.189	0.521	0.008
Rv2124c.1	30	2ij7_TPF_F_2474 PDB CREDO	0.573	0.213	0.520	0.008
Rv2124c.1	9	3ads_IMN_A_1 PDB CREDO	0.548	0.247	0.520	0.008
Rv2124c.3	3	2aa5_STR_A_301 PDB CREDO	0.589	0.192	0.518	0.008
Rv2124c.1	23	3ri5_IVM_E_349 PDB CREDO	0.718	0.067	0.518	0.008
Rv2124c.1	30	3ua5_06X_A_501 PDB CREDO	0.517	0.292	0.517	0.008
Rv2124c.3	3	3rgf_BAX_A_465 PDB CREDO	0.617	0.159	0.517	0.008
Rv2124c.3	3	3ufn_ROC_A_401 PDB CREDO	0.726	0.062	0.516	0.009
Rv2124c.3	3	1d4s_TPV_A_201 PDB CREDO	0.606	0.172	0.516	0.009
Rv2124c.1	14	1hwk_117_A_2 PDB CREDO	0.602	0.177	0.516	0.009
Rv2124c.1	14	1hwk_117_C_4 PDB CREDO	0.601	0.178	0.515	0.009
Rv2124c.1	30	2ij7_TPF_A_2472 PDB CREDO	0.540	0.258	0.515	0.009
Rv2124c.1	30	2ij7_TPF_D_2473 PDB CREDO	0.540	0.258	0.515	0.009
Rv2124c.1	30	3tbg_RTZ_A_2 PDB CREDO	0.540	0.258	0.515	0.009
Rv2124c.1	30	3tbg_RTZ_C_2 PDB CREDO	0.540	0.258	0.515	0.009
Rv2124c.1	14	2nni_MTK_A_501 PDB CREDO	0.618	0.158	0.514	0.009
Rv2124c.1	9	1s14_NOV_A_1300 PDB CREDO	0.514	0.297	0.514	0.009
Rv2124c.3	3	1a28_STR_A_1 PDB CREDO	0.669	0.106	0.513	0.009
Rv2124c.1	30	2ij7_TPF_B_2470 PDB CREDO	0.539	0.260	0.513	0.009
Rv2124c.3	3	3sm2_478_A_126 PDB CREDO	0.780	0.033	0.513	0.009
Rv2124c.3	3	3el0_1UN_A_201 PDB CREDO	0.630	0.145	0.513	0.009
Rv2124c.3	3	2h42_VIA_C_903 PDB CREDO	0.692	0.087	0.512	0.009
Rv2124c.3	3	2fum_MIX_A_539 PDB CREDO	0.691	0.088	0.512	0.009
Rv2124c.1	14	3tkd_CYZ_A_266 PDB CREDO	0.528	0.276	0.511	0.009
Rv2124c.1	23	1jg2_ADN_A_500 PDB CREDO	0.547	0.247	0.511	0.009
Rv2124c.1	30	3sxr_1N1_B_2 PDB CREDO	0.763	0.041	0.511	0.009
Rv2124c.1	30	1lii_ADN_A_699 PDB CREDO	0.511	0.301	0.511	0.009
Rv2124c.1	9	2jih_097_B_1001 PDB CREDO	0.511	0.302	0.511	0.009
Rv2124c.3	3	3qt0_486_A_4 PDB CREDO	0.621	0.155	0.511	0.009
Rv2124c.1	14	3ut5_LOC_D_502 PDB CREDO	0.527	0.277	0.510	0.009
Rv2124c.3	3	1n49_RIT_B_301 PDB CREDO	0.645	0.130	0.510	0.009
Rv2124c.3	26	1kij_NOV_B_444 PDB CREDO	0.530	0.273	0.510	0.009
Rv2124c.1	30	3hbb_TMQ_B_612 PDB CREDO	0.510	0.303	0.510	0.009
Rv2124c.1	23	3q70_RIT_A_2001 PDB CREDO	0.637	0.138	0.510	0.009
Rv2124c.1	14	1hwi_115_C_4 PDB CREDO	0.602	0.177	0.509	0.009
Rv2124c.1	30	3clb_TMQ_D_614 PDB CREDO	0.561	0.229	0.509	0.009
Rv2124c.1	14	3n58_ADN_A_500 PDB CREDO	0.623	0.153	0.509	0.009
Rv2124c.1	9	3hy7_097_A_801 PDB CREDO	0.536	0.264	0.509	0.010
Rv2124c.3	3	3ut5_LOC_B_502 PDB CREDO	0.525	0.281	0.509	0.010
Rv2124c.1	30	3hbb_TMQ_D_614 PDB CREDO	0.560	0.231	0.508	0.010
Rv2124c.3	3	3lzv_017_A_200 PDB CREDO	0.625	0.151	0.508	0.010
Rv2124c.3	3	3tkd_CYZ_A_266 PDB CREDO	0.524	0.281	0.508	0.010
Rv2124c.3	3	3tne_RIT_B_401 PDB CREDO	0.524	0.281	0.508	0.010
Rv2124c.3	3	2o4n_TPV_A_300 PDB CREDO	0.524	0.282	0.508	0.010
Rv2124c.1	9	4dt8_ADN_B_401 PDB CREDO	0.508	0.306	0.508	0.010
Rv2124c.3	3	1fm6_BRL_D_503 PDB CREDO	0.662	0.113	0.508	0.010
Rv2124c.1	30	1fdw_EST_A_350 PDB CREDO	0.625	0.151	0.507	0.010
Rv2124c.1	30	3um5_CP6_A_609 PDB CREDO	0.590	0.191	0.506	0.010
Rv2124c.3	26	2y7j_B49_B_1294 PDB CREDO	0.590	0.191	0.505	0.010
Rv2124c.1	30	2w3v_TOP_A_1169 PDB CREDO	0.530	0.272	0.505	0.010
Rv2124c.1	30	3ik6_HCZ_B_800 PDB CREDO	0.531	0.272	0.505	0.010
Rv2124c.1	30	3um5_CP6_B_709 PDB CREDO	0.589	0.193	0.505	0.010
Rv2124c.1	9	3o0q_ADN_A_1004 PDB CREDO	0.532	0.270	0.504	0.010
Rv2124c.1	14	1hwk_117_B_1 PDB CREDO	0.623	0.153	0.504	0.010
Rv2124c.3	3	3jwq_VIA_B_901 PDB CREDO	0.680	0.097	0.503	0.010
Rv2124c.1	14	2c49_ADN_A_1301 PDB CREDO	0.741	0.053	0.503	0.010
Rv2124c.1	30	3clb_TMQ_B_612 PDB CREDO	0.580	0.203	0.503	0.010
Rv2124c.1	14	3ut5_LOC_B_502 PDB CREDO	0.552	0.241	0.503	0.010
Rv2124c.3	3	2aoj_FRD_C_305 PDB CREDO	0.567	0.220	0.503	0.010
Rv2124c.3	3	3el9_DR7_A_100 PDB CREDO	0.671	0.105	0.503	0.010
Rv2124c.1	30	3ijx_HCZ_B_800 PDB CREDO	0.528	0.275	0.502	0.011
Rv2124c.1	9	3o0q_ADN_B_1004 PDB CREDO	0.530	0.273	0.502	0.011
Rv2124c.1	9	3hy7_097_B_801 PDB CREDO	0.529	0.274	0.502	0.011
Rv2124c.1	30	3tbg_RTZ_B_1 PDB CREDO	0.552	0.241	0.502	0.011
Rv2124c.3	3	2r5q_1UN_D_900 PDB CREDO	0.565	0.223	0.501	0.011
Rv2124c.3	3	2r5q_1UN_B_900 PDB CREDO	0.565	0.224	0.501	0.011
Rv2124c.1	9	2x0p_ADN_A_1607 PDB CREDO	0.559	0.232	0.501	0.011
Rv2124c.1	30	1udu_CIA_A_1003 PDB CREDO	0.526	0.279	0.501	0.011
Rv2124c.3	3	2prg_BRL_A_1 PDB CREDO	0.652	0.122	0.500	0.011
Rv2124c.3	3	3ogp_017_B_200 PDB CREDO	0.581	0.203	0.500	0.011

Similarity to known drug target from sensitive sequence analysis

No drug targets

List of small molecules tested from TIBLE

Data not available

Off-target activity - ligand based from TIBLE

Data not available

Small molecules involved in protein-protein complex from TIMBAL .Proteins similar to Mtb based on sequence analysis.

Data not available

STITCH interactions

Chemical Name	Confidence score	Molecular Weight
5-methyltetrahydrofolatePubChem	0.996	459.456
methyltetrahydrofolatePubChem	0.995	459.456
homocysteinePubChem	0.992	135.185
S-adenosyl-L-methioninePubChem	0.989	399.445
L-homocysteinePubChem	0.98	135.185
cystathioninePubChem	0.978	222.262
acetatePubChem	0.969	59.044
tetrahydrofolatePubChem	0.966	445.429
S-adenosyl-methioninePubChem	0.964	398.437
5,10-methylenetetrahydrofolatePubChem	0.955	457.44
L-methioninePubChem	0.949	149.211
N5,N10-methylenetetrahydrofolatePubChem	0.937	457.44
H4FPubChem	0.931	445.429
phosphatePubChem	0.921	96.9872
ammoniaPubChem	0.92	17.0305
sulphurPubChem	0.919	34.0809
hydroxyl radicalsPubChem	0.918	17.0073
carbon dioxidePubChem	0.902	44.0095
polyglycinePubChem	0.902	75.0666
pyrophosphatePubChem	0.9	177.975
L-serinePubChem	0.9	105.093
L-cystathioninePubChem	0.9	222.262
NAD+PubChem	0.9	663.425
adenosine triphosphatePubChem	0.9	507.181
H(+)PubChem	0.9	2.01588
protiumPubChem	0.9	2.01576
pyruvic acidPubChem	0.9	88.0621
O-acetyl-L-homoserinePubChem	0.9	161.156
reduced nicotinamide adenine dinucleotidePubChem	0.9	665.441
DL-serinePubChem	0.9	105.093
deuteriumPubChem	0.9	2.01588
dihydronicotinamide formycin dinucleotidePubChem	0.9	665.441
C09332PubChem	0.9	574.543
folatePubChem	0.874	441.397
S-adenosylhomocysteinePubChem	0.858	384.411
vitamin B12PubChem	0.856	1354.36
cob(II)alaminPubChem	0.847	1332.37
methylcobalaminPubChem	0.847	1344.38
Na(+)PubChem	0.831	22.9898
nitrous oxidePubChem	0.83	44.0128
hydroxocobalaminPubChem	0.805	1347.36
MeCblPubChem	0.798	1344.38
betainePubChem	0.789	117.146
potassiumPubChem	0.782	39.0983
selenomethioninePubChem	0.738	196.106
potassium hydridePubChem	0.732	40.1062
SeMetPubChem	0.732	196.106
cobaltPubChem	0.703	117.866