SInCRe - Rv2065

Tuberculist information

Gene name	cobH
Protein function	Precorrin-8X methylmutase CobH (aka precorrin isomerase)
Functional category(tuberculist)	intermediary metabolism and respiration
Gene location(kb)	2322.55
Molecular mass(da)	21581.7
External sites	TB Database TubercuList WebTB

Protein sequence

Number of amino acids : 208

	  		  	1    VLDYLRDAAEIYRRSFAVIRAEADLARFPADVARVVVRLIHTCGQVDVAEHVAYTDDVVA   60
			  	61   RAGAALAAGAPVLCDSSMVAAGITTSRLPADNQIVSLVADPRATELAARRQTTRSAAGVE  120
			  	121  LCAERLPGAVLAIGNAPTALFRLLELVDEGAPPPAAVLGGPVGFVGSAQAKEELIERPRG  180
			  	181  MSYLVVRGRRGGSAMAAAAVNAIASDRE

Known structures in the PDB

No Known structures

Number of amino acids : 208

Domains assigned based on sequence.

Mtb Structural proteome models

CHOPIN models

Profile-based domain assignment

Structural/Functional domain family	Pfam acc.no./SCOP ID	Domain Region
CbiC	PF02570	10-208

Mtb Structural Proteome models

Model Number	1
Model name	Rv2065
Template	1F2V APDB CREDO
Template coverage	5_207
Template Identity(%)	55.2
Model coverage(%)	97.1
Normalized DOPE score	-0.749

Structure Models from Chopin

Model Number	1
Profile	c.23.17.1 - 3.40.50.10230 Click for model details
zscore	42.77
Residue begin	1
Residue end	208

Binding pockets

STRING

Cytoscape Web will replace the contents of this div with protein-protein interaction network.

Protein interacting with Rv2065	Gene name	Confidence Score
Rv2066	cobI	0.999
Rv2072c	cobL	0.997
Rv2072c	cobL	0.997
Rv2848c	cobB	0.996
Rv2848c	cobB	0.996
Rv2064	cobG	0.993
Rv2071c	cobM	0.993
Rv2070c	cobK	0.988
Rv2062c	cobN	0.968
Rv2236c	cobD	0.959
Rv0255c	cobQ1	0.955
Rv0255c	cobQ1	0.955
Rv0254c	cobU	0.946
Rv0524	hemL	0.937
Rv2207	cobT	0.936
Rv2208	cobS	0.933
Rv2393	che1	0.93
Rv0509	hemA	0.929
Rv0509	hemA	0.929
Rv0509	hemA	0.929
Rv2849c	cobO	0.912
Rv2847c	cysG	0.902
Rv2847c	cysG	0.902

Potential ligand/drug binding sites

No binding sites identified

Similarity to known drug target from sensitive sequence analysis

No drug targets

List of small molecules tested from TIBLE

Data not available

Off-target activity - ligand based from TIBLE

Data not available

Small molecules involved in protein-protein complex from TIMBAL .Proteins similar to Mtb based on sequence analysis.

Data not available

STITCH interactions

Chemical Name	Confidence score	Molecular Weight
precorrin-8xPubChem	0.975	880.976
COJPubChem	0.968	880.976
hydrogenobyrinic acidPubChem	0.968	880.976
CPD-688PubChem	0.9	874.975
S-adenosylhomocysteinePubChem	0.9	384.411
phosphatePubChem	0.9	96.9872
H(+)PubChem	0.9	2.01588
adenosine triphosphatePubChem	0.9	507.181
protiumPubChem	0.9	2.01576
cobyrinic acidPubChem	0.9	938.902
S-adenosyl-methioninePubChem	0.9	398.437
polyglutaminePubChem	0.9	146.145
hydrogenobyrinic acid a,c-diamidePubChem	0.9	879.007
Precorrin 8xPubChem	0.9	880.976
hydroxyl radicalsPubChem	0.9	17.0073
glutaminPubChem	0.9	146.145
adenosine diphosphatePubChem	0.9	427.201
S-adenosyl-L-methioninePubChem	0.9	399.445
Precorrin 6bPubChem	0.9	896.933
carbon dioxidePubChem	0.9	44.0095
precorrin-6yPubChem	0.9	896.933
CPD-687PubChem	0.9	880.976
glutamatePubChem	0.9	147.129
deuteriumPubChem	0.9	2.01588
chloridePubChem	0.776	35.453