SInCRe - Rv2848c

Tuberculist information

Gene name	cobB
Protein function	Probable cobyrinic acid A,C-diamide synthase CobB
Functional category(tuberculist)	intermediary metabolism and respiration
Gene location(kb)	3156.15
Molecular mass(da)	46958.3
External sites	TB Database TubercuList WebTB

Protein sequence

Number of amino acids : 457

	  		  	1    MRVSAVAVAAPASGSGKTTIATGLIGALRQAGHTVAPFKVGPDFIDPGYHALAAGRPGRN   60
			  	61   LDPVLVGERLIGPLYAHGVAGADIAVIEGVLGLFDGRIGPAGGAPAAGSTAHVAALLGAP  120
			  	121  VILVVDARGQSHSVAALLHGFSTFDTATRIAGVILNRVGSARHEQVLRQACDQAGVAVLG  180
			  	181  AIPRTAELELPTRYLGLVTAVEYGRRARLAVQAMTAVVARHVDLAAVIACAGSQAAHPPW  240
			  	241  DPVIAVGNTARQPATVAIAAGRAFTFGYAEHAEMLRAAGAEVVEFDPLSETLPEGTDAVV  300
			  	301  LPGGFPEQFTAELSANDTVRRQINELAAAGAPVHAECAGLLYLVSELDGHPMCGVVAGSA  360
			  	361  RFTQHLKLGYRDAVAVVDSALYSVGERVVGHEFHRTAVTFADSYQPAWVYQGQDVDDVRD  420
			  	421  GAVHSGVHASYLHTHPAATPGAVARFVAHAACNTPRA

Known structures in the PDB

No Known structures

Number of amino acids : 457

Domains assigned based on sequence.

Mtb Structural proteome models

CHOPIN models

Profile-based domain assignment

Structural/Functional domain family	Pfam acc.no./SCOP ID	Domain Region
CbiA	PF01656	6-198
GATase_3	PF07685	289-441

Mtb Structural Proteome models

Model Number	1
Model name	Rv2848c.1
Template	1BYI APDB CREDO
Template coverage	2_208
Template Identity(%)	22.3
Model coverage(%)	40.0
Normalized DOPE score	-0.42

Model Number	2
Model name	Rv2848c
Template	1Q7R APDB CREDO
Template coverage	9_193
Template Identity(%)	21.1
Model coverage(%)	42.0
Normalized DOPE score	0.029

Structure Models from Chopin

Model Number	1
Profile	c.23.16.1 - 3.40.50.880 Click for model details
zscore	11.02
Residue begin	289
Residue end	441

Binding pockets

STRING

Cytoscape Web will replace the contents of this div with protein-protein interaction network.

Protein interacting with Rv2848c	Gene name	Confidence Score
Rv2065	cobH	0.996
Rv2062c	cobN	0.995
Rv0255c	cobQ1	0.994
Rv0255c	cobQ1	0.994
Rv2849c	cobO	0.993
Rv2207	cobT	0.989
Rv2236c	cobD	0.988
Rv2071c	cobM	0.984
Rv2066	cobI	0.983
Rv0254c	cobU	0.974
Rv2070c	cobK	0.964
Rv2208	cobS	0.96
Rv2847c	cysG	0.959
Rv2847c	cysG	0.959
Rv2850c	Rv2850c	0.95
Rv2850c	Rv2850c	0.95
Rv2231c	cobC	0.932
Rv2072c	cobL	0.929
Rv2072c	cobL	0.929
Rv1314c	Rv1314c	0.904

Potential ligand/drug binding sites

Protein Model	Pocket Number	Drug Binding Site	PMIN Score	Pvalue PMIN	PMAX Score	Pvalue PMAX
Rv2848c.1	2	1ya4_CTX_B_2 PDB CREDO	0.684	0.094	0.658	0.001
Rv2848c.1	2	3erd_DES_B_800 PDB CREDO	0.744	0.051	0.641	0.001
Rv2848c.1	2	3bbt_FMM_B_91 PDB CREDO	0.661	0.114	0.636	0.001
Rv2848c.1	2	1ya4_CTX_C_3 PDB CREDO	0.661	0.114	0.636	0.001
Rv2848c.1	2	3uud_EST_A_600 PDB CREDO	0.674	0.102	0.623	0.001
Rv2848c.1	2	1g50_EST_A_600 PDB CREDO	0.673	0.103	0.622	0.001
Rv2848c.1	2	2yja_EST_B_1550 PDB CREDO	0.673	0.103	0.622	0.001
Rv2848c.1	2	3ols_EST_A_600 PDB CREDO	0.671	0.105	0.620	0.001
Rv2848c.1	2	3ols_EST_B_600 PDB CREDO	0.671	0.105	0.620	0.001
Rv2848c.1	2	3uud_EST_B_600 PDB CREDO	0.669	0.106	0.618	0.001
Rv2848c.1	2	3lfa_1N1_A_361 PDB CREDO	0.706	0.076	0.600	0.002
Rv2848c.1	2	2j7y_E3O_A_1454 PDB CREDO	0.621	0.154	0.598	0.002
Rv2848c.1	2	1mx1_THA_D_4 PDB CREDO	0.616	0.160	0.593	0.002
Rv2848c.1	2	3erd_DES_A_600 PDB CREDO	0.684	0.093	0.589	0.003
Rv2848c.1	2	1mx1_THA_F_6 PDB CREDO	0.612	0.165	0.588	0.003
Rv2848c.1	2	1mx1_THA_E_5 PDB CREDO	0.654	0.121	0.584	0.003
Rv2848c.1	2	3bbt_FMM_D_91 PDB CREDO	0.749	0.048	0.580	0.003
Rv2848c.1	2	1s9p_DES_D_600 PDB CREDO	0.692	0.087	0.575	0.003
Rv2848c.1	2	3qlg_1N1_A_601 PDB CREDO	0.571	0.216	0.571	0.004
Rv2848c.1	2	3qlg_1N1_B_601 PDB CREDO	0.571	0.216	0.571	0.004
Rv2848c.1	2	3g5d_1N1_B_1 PDB CREDO	0.570	0.217	0.570	0.004
Rv2848c.1	2	1s9p_DES_B_459 PDB CREDO	0.590	0.191	0.567	0.004
Rv2848c.1	2	1s9p_DES_C_500 PDB CREDO	0.588	0.193	0.566	0.004
Rv2848c.1	2	2zva_1N1_A_513 PDB CREDO	0.588	0.193	0.566	0.004
Rv2848c.1	2	3ads_IMN_B_3 PDB CREDO	0.693	0.086	0.565	0.004
Rv2848c.1	2	3oht_1N1_B_1000 PDB CREDO	0.677	0.099	0.563	0.004
Rv2848c.1	2	1s9p_DES_A_459 PDB CREDO	0.676	0.100	0.562	0.004
Rv2848c.1	2	1mx1_THA_C_3 PDB CREDO	0.673	0.103	0.559	0.004
Rv2848c.1	2	1a52_EST_A_1 PDB CREDO	0.685	0.092	0.559	0.004
Rv2848c.1	2	3adx_IMN_B_3 PDB CREDO	0.605	0.173	0.559	0.004
Rv2848c.1	2	3hm1_J3Z_B_1 PDB CREDO	0.685	0.092	0.559	0.004
Rv2848c.1	2	3spk_TPV_A_100 PDB CREDO	0.745	0.051	0.558	0.004
Rv2848c.1	2	3g5d_1N1_A_1 PDB CREDO	0.558	0.233	0.558	0.004
Rv2848c.1	2	1a52_EST_B_2 PDB CREDO	0.684	0.094	0.557	0.004
Rv2848c.1	2	1jg2_ADN_A_500 PDB CREDO	0.693	0.086	0.556	0.005
Rv2848c.1	2	3oht_1N1_A_1000 PDB CREDO	0.600	0.180	0.556	0.005
Rv2848c.1	2	1ere_EST_F_600 PDB CREDO	0.679	0.098	0.554	0.005
Rv2848c.1	2	2j7x_EST_A_1454 PDB CREDO	0.678	0.099	0.553	0.005
Rv2848c.1	2	3oll_EST_B_600 PDB CREDO	0.678	0.099	0.553	0.005
Rv2848c.1	2	1ere_EST_D_600 PDB CREDO	0.677	0.099	0.552	0.005
Rv2848c.1	2	1pcg_EST_A_1 PDB CREDO	0.677	0.099	0.552	0.005
Rv2848c.1	2	3oll_EST_A_600 PDB CREDO	0.677	0.099	0.552	0.005
Rv2848c.1	2	1ere_EST_C_600 PDB CREDO	0.676	0.100	0.551	0.005
Rv2848c.1	2	1qkt_EST_A_600 PDB CREDO	0.676	0.100	0.551	0.005
Rv2848c.1	2	1jg3_ADN_B_550 PDB CREDO	0.551	0.243	0.551	0.005
Rv2848c.1	2	1g50_EST_C_2600 PDB CREDO	0.674	0.102	0.550	0.005
Rv2848c.1	2	1mx1_THA_B_2 PDB CREDO	0.619	0.157	0.549	0.005
Rv2848c.1	2	1jg3_ADN_A_500 PDB CREDO	0.614	0.163	0.548	0.005
Rv2848c.1	2	2ocf_EST_A_596 PDB CREDO	0.670	0.106	0.546	0.005
Rv2848c.1	2	2ito_IRE_A_2020 PDB CREDO	0.564	0.225	0.543	0.006
Rv2848c.1	4	3mg0_BO2_V_1401 PDB CREDO	0.542	0.256	0.542	0.006
Rv2848c.1	2	3sxr_1N1_A_1 PDB CREDO	0.552	0.241	0.531	0.007
Rv2848c.1	4	3mg0_BO2_H_1400 PDB CREDO	0.551	0.242	0.526	0.007
Rv2848c.1	2	2ity_IRE_A_2020 PDB CREDO	0.547	0.248	0.526	0.007
Rv2848c.1	2	3kw2_ADN_B_300 PDB CREDO	0.546	0.250	0.525	0.007
Rv2848c.1	2	1mx1_THA_A_1 PDB CREDO	0.611	0.166	0.520	0.008
Rv2848c.1	4	3ny4_SMX_A_308 PDB CREDO	0.519	0.289	0.519	0.008
Rv2848c.1	2	2itz_IRE_A_2021 PDB CREDO	0.553	0.240	0.511	0.009
Rv2848c.1	2	3sxr_1N1_B_2 PDB CREDO	0.551	0.243	0.509	0.009
Rv2848c.1	2	3ogp_017_A_200 PDB CREDO	0.836	0.013	0.502	0.011
Rv2848c.1	2	1dtl_BEP_A_204 PDB CREDO	0.543	0.254	0.502	0.011

Similarity to known drug target from sensitive sequence analysis

No drug targets

List of small molecules tested from TIBLE

Data not available

Off-target activity - ligand based from TIBLE

Data not available

Small molecules involved in protein-protein complex from TIMBAL .Proteins similar to Mtb based on sequence analysis.

Data not available

STITCH interactions

Chemical Name	Confidence score	Molecular Weight
hydrogenobyrinic acidPubChem	0.943	880.976
COJPubChem	0.943	880.976
cobyrinic acidPubChem	0.941	938.902
CPD-688PubChem	0.9	874.975
phosphatePubChem	0.9	96.9872
CPD-694PubChem	0.9	936.932
adenosine triphosphatePubChem	0.9	507.181
precorrin-8xPubChem	0.9	880.976
H(+)PubChem	0.9	2.01588
polyglutaminePubChem	0.9	146.145
cob(II)yrinic acid a,c-diamidePubChem	0.9	936.932
CPD-687PubChem	0.9	880.976
hydroxyl radicalsPubChem	0.9	17.0073
Precorrin 8xPubChem	0.9	880.976
cobaltPubChem	0.9	117.866
adenosine diphosphatePubChem	0.9	427.201
glutaminPubChem	0.9	146.145
glutamatePubChem	0.9	147.129
hydrogenobyrinic acid a,c-diamidePubChem	0.9	879.007
protiumPubChem	0.9	2.01576
deuteriumPubChem	0.9	2.01588