SInCRe - Rv2850c

Tuberculist information

Gene name	Rv2850c
Protein function	Possible magnesium chelatase
Functional category(tuberculist)	intermediary metabolism and respiration
Gene location(kb)	3158.17
Molecular mass(da)	66955
External sites	TB Database TubercuList WebTB

Protein sequence

Number of amino acids : 629

	  		  	1    VKPYPFSAIVGHDRLRLALLLCAVRPEIGGALIRGEKGTAKSTAVRGLAALLSVATGSTE   60
			  	61   TGLVELPLGATEDRVVGSLDLQRVMRDGEHAFSPGLLARAHGGVLYVDEVNLLHDHLVDI  120
			  	121  LLDAAAMGRVHVERDGISHSHEARFVLIGTMNPEEGELRPQLLDRFGLTVDVQASRDIDV  180
			  	181  RVQVIRRRMAYEADPDAFVARYADADAELAHRIAAARATVDDVVLGDNELRRIAALCAAF  240
			  	241  DVDGMRADLVVARTAAAHAAWRGVRTVEEQDIRAAAELALPHRRRRDPFDDHGIDRDQLD  300
			  	301  EALALASVDPEPEPDPPGGGQSANEPASQPNSRSKSTEPGAPSSMGDDPPRPASPRLRSS  360
			  	361  PRPSAPPSKIFRTRALRVPGVGTGAPGRRSRARNASGSVVAAAEVSDPDAHGLHLFATLL  420
			  	421  AAGERAFGAGPLRPWPDDVRRAIREGREGNLVIFVVDASGSMAARDRMAAVSGATLSLLR  480
			  	481  DAYQRRDKVAVITFRQHEATLLLSPTSSAHIAGRRLARFSTGGKTPLAEGLLAARALIIR  540
			  	541  EKVRDRARRPLVVVLTDGRATAGPDPLGRSRTAAAGLVAEGAAAVVVDCETSYVRLGLAA  600
			  	601  QLARQLGAPVVRLEQLHADYLVHAVRGVA

Known structures in the PDB

No Known structures

Number of amino acids : 629

Domains assigned based on sequence.

Mtb Structural proteome models

CHOPIN models

Profile-based domain assignment

Structural/Functional domain family	Pfam acc.no./SCOP ID	Domain Region
AAA_5	PF07728	30-166
VWA_2	PF13519	451-620

Mtb Structural Proteome models

Model Number	1
Model name	Rv2850c.4
Template	1PT6 APDB CREDO
Template coverage	142_328
Template Identity(%)	17.7
Model coverage(%)	28.6
Normalized DOPE score	-0.515

Model Number	2
Model name	Rv2850c
Template	1G8P APDB CREDO
Template coverage	18_350
Template Identity(%)	51.4
Model coverage(%)	46.6
Normalized DOPE score	-0.452

Model Number	3
Model name	Rv2850c.3
Template	1MF7 APDB CREDO
Template coverage	129_312
Template Identity(%)	12.6
Model coverage(%)	28.9
Normalized DOPE score	-0.361

Model Number	4
Model name	Rv2850c.2
Template	1IQP APDB CREDO
Template coverage	20_322
Template Identity(%)	18.2
Model coverage(%)	54.5
Normalized DOPE score	0.783

Structure Models from Chopin

Model Number	1
Profile	c.62.1.5 Click for model details
zscore	14.3
Residue begin	445
Residue end	613

Model Number	2
Profile	1.10.8.300, 1.20.5.420, 3.40.50.300 Click for model details
zscore	12.28
Residue begin	1
Residue end	311

Model Number	3
Profile	c.37.1.20 Click for model details
zscore	10.96
Residue begin	8
Residue end	189

Model Number	4
Profile	1.10.8.300 Click for model details
zscore	4.45
Residue begin	207
Residue end	307

Binding pockets

STRING

Cytoscape Web will replace the contents of this div with protein-protein interaction network.

Protein interacting with Rv2850c	Gene name	Confidence Score
Rv2062c	cobN	0.989
Rv1485	hemZ	0.952
Rv2848c	cobB	0.95
Rv2848c	cobB	0.95
Rv2849c	cobO	0.939
Rv2677c	hemY	0.905
Rv2677c	hemY	0.905

Potential ligand/drug binding sites

Protein Model	Pocket Number	Drug Binding Site	PMIN Score	Pvalue PMIN	PMAX Score	Pvalue PMAX
Rv2850c.2	11	1jg2_ADN_A_500 PDB CREDO	0.717	0.068	0.693	0.000
Rv2850c.2	11	3spk_TPV_A_100 PDB CREDO	0.712	0.072	0.689	0.000
Rv2850c.2	11	3bbt_FMM_D_91 PDB CREDO	0.645	0.130	0.645	0.001
Rv2850c.2	11	1jg3_ADN_A_500 PDB CREDO	0.725	0.063	0.629	0.001
Rv2850c.4	6	1ya4_CTX_C_3 PDB CREDO	0.704	0.078	0.623	0.001
Rv2850c.4	6	1ya4_CTX_B_2 PDB CREDO	0.703	0.079	0.622	0.001
Rv2850c.2	11	3oht_1N1_B_1000 PDB CREDO	0.667	0.109	0.622	0.001
Rv2850c.2	2	3oxc_ROC_A_401 PDB CREDO	0.633	0.142	0.620	0.001
Rv2850c.4	6	3ols_EST_A_600 PDB CREDO	0.670	0.105	0.617	0.002
Rv2850c.4	6	3ols_EST_B_600 PDB CREDO	0.668	0.108	0.615	0.002
Rv2850c.4	6	3uud_EST_A_600 PDB CREDO	0.667	0.109	0.614	0.002
Rv2850c.2	2	3k4v_ROC_B_201 PDB CREDO	0.639	0.135	0.613	0.002
Rv2850c.4	6	2j7x_EST_A_1454 PDB CREDO	0.639	0.135	0.613	0.002
Rv2850c.4	6	1g50_EST_A_600 PDB CREDO	0.665	0.110	0.612	0.002
Rv2850c.4	6	2yja_EST_B_1550 PDB CREDO	0.665	0.110	0.612	0.002
Rv2850c.4	6	3uud_EST_B_600 PDB CREDO	0.665	0.110	0.612	0.002
Rv2850c.4	6	3hm1_J3Z_B_1 PDB CREDO	0.638	0.136	0.612	0.002
Rv2850c.4	6	1a52_EST_A_1 PDB CREDO	0.637	0.137	0.611	0.002
Rv2850c.4	6	1pcg_EST_A_1 PDB CREDO	0.636	0.138	0.610	0.002
Rv2850c.4	6	1qkt_EST_A_600 PDB CREDO	0.636	0.138	0.610	0.002
Rv2850c.4	6	1a52_EST_B_2 PDB CREDO	0.636	0.139	0.609	0.002
Rv2850c.4	6	1ere_EST_C_600 PDB CREDO	0.636	0.139	0.609	0.002
Rv2850c.4	6	1ere_EST_F_600 PDB CREDO	0.635	0.140	0.608	0.002
Rv2850c.4	6	1ere_EST_D_600 PDB CREDO	0.634	0.141	0.607	0.002
Rv2850c.2	2	3nu5_478_B_401 PDB CREDO	0.607	0.171	0.607	0.002
Rv2850c.2	2	3ndt_ROC_A_101 PDB CREDO	0.646	0.128	0.607	0.002
Rv2850c.2	2	3tkg_ROC_B_801 PDB CREDO	0.617	0.159	0.604	0.002
Rv2850c.4	6	1g50_EST_C_2600 PDB CREDO	0.630	0.145	0.604	0.002
Rv2850c.2	11	1sa1_POD_D_701 PDB CREDO	0.780	0.033	0.603	0.002
Rv2850c.4	6	3oll_EST_B_600 PDB CREDO	0.629	0.146	0.603	0.002
Rv2850c.4	6	2ocf_EST_A_596 PDB CREDO	0.627	0.148	0.601	0.002
Rv2850c.4	6	3oll_EST_A_600 PDB CREDO	0.627	0.148	0.601	0.002
Rv2850c.2	11	2ito_IRE_A_2020 PDB CREDO	0.746	0.050	0.601	0.002
Rv2850c.2	11	3e22_LOC_D_700 PDB CREDO	0.708	0.075	0.601	0.002
Rv2850c.2	11	3e22_LOC_B_700 PDB CREDO	0.705	0.077	0.599	0.002
Rv2850c.2	11	1sa1_POD_B_700 PDB CREDO	0.795	0.026	0.597	0.002
Rv2850c.2	2	2f8g_017_B_401 PDB CREDO	0.596	0.184	0.596	0.002
Rv2850c.2	2	3s54_017_B_201 PDB CREDO	0.591	0.189	0.591	0.002
Rv2850c.2	11	3ut5_LOC_D_502 PDB CREDO	0.695	0.085	0.590	0.003
Rv2850c.2	11	2fum_MIX_D_3539 PDB CREDO	0.590	0.192	0.590	0.003
Rv2850c.2	2	3jvy_017_B_401 PDB CREDO	0.642	0.133	0.588	0.003
Rv2850c.2	2	3ucb_017_A_201 PDB CREDO	0.737	0.056	0.588	0.003
Rv2850c.4	6	3lfa_1N1_A_361 PDB CREDO	0.586	0.196	0.586	0.003
Rv2850c.2	11	1s9p_DES_A_459 PDB CREDO	0.624	0.151	0.582	0.003
Rv2850c.4	1	2ocf_EST_A_596 PDB CREDO	0.635	0.139	0.582	0.003
Rv2850c.2	11	1mx1_THA_C_3 PDB CREDO	0.623	0.152	0.582	0.003
Rv2850c.4	1	1a52_EST_A_1 PDB CREDO	0.634	0.140	0.581	0.003
Rv2850c.4	1	2j7x_EST_A_1454 PDB CREDO	0.633	0.141	0.580	0.003
Rv2850c.4	1	3hm1_J3Z_B_1 PDB CREDO	0.633	0.141	0.580	0.003
Rv2850c.4	1	1ya4_CTX_C_3 PDB CREDO	0.744	0.051	0.578	0.003
Rv2850c.2	2	3qoz_017_A_201 PDB CREDO	0.645	0.130	0.578	0.003
Rv2850c.4	1	1a52_EST_B_2 PDB CREDO	0.630	0.145	0.577	0.003
Rv2850c.4	1	1pcg_EST_A_1 PDB CREDO	0.630	0.145	0.577	0.003
Rv2850c.4	1	1qkt_EST_A_600 PDB CREDO	0.630	0.145	0.577	0.003
Rv2850c.2	2	3ndu_ROC_D_100 PDB CREDO	0.659	0.116	0.577	0.003
Rv2850c.4	1	1ere_EST_C_600 PDB CREDO	0.629	0.146	0.576	0.003
Rv2850c.4	1	1ere_EST_F_600 PDB CREDO	0.629	0.146	0.576	0.003
Rv2850c.2	2	2nmy_ROC_A_401 PDB CREDO	0.643	0.132	0.576	0.003
Rv2850c.2	11	1jg3_ADN_B_550 PDB CREDO	0.743	0.052	0.576	0.003
Rv2850c.4	1	1ere_EST_D_600 PDB CREDO	0.628	0.147	0.575	0.003
Rv2850c.3	9	3ret_SAL_B_201 PDB CREDO	0.644	0.131	0.575	0.003
Rv2850c.2	2	3d1x_ROC_A_201 PDB CREDO	0.587	0.194	0.575	0.003
Rv2850c.2	11	3spk_TPV_B_100 PDB CREDO	0.788	0.029	0.575	0.003
Rv2850c.4	1	3oll_EST_A_600 PDB CREDO	0.627	0.148	0.574	0.003
Rv2850c.4	1	1ya4_CTX_B_2 PDB CREDO	0.739	0.054	0.574	0.003
Rv2850c.4	1	3oll_EST_B_600 PDB CREDO	0.626	0.149	0.574	0.003
Rv2850c.2	2	3tl9_ROC_A_401 PDB CREDO	0.612	0.165	0.573	0.003
Rv2850c.2	2	3mws_017_B_201 PDB CREDO	0.585	0.197	0.573	0.003
Rv2850c.2	2	2ien_017_B_402 PDB CREDO	0.625	0.150	0.573	0.003
Rv2850c.2	2	2o4s_AB1_A_400 PDB CREDO	0.585	0.197	0.573	0.003
Rv2850c.2	11	3oht_1N1_A_1000 PDB CREDO	0.683	0.094	0.572	0.003
Rv2850c.2	2	3cyx_ROC_A_201 PDB CREDO	0.651	0.123	0.570	0.004
Rv2850c.2	11	3so9_017_A_100 PDB CREDO	0.714	0.070	0.570	0.004
Rv2850c.2	2	2ieo_017_A_402 PDB CREDO	0.681	0.096	0.570	0.004
Rv2850c.3	9	3hgx_SAL_B_104 PDB CREDO	0.637	0.138	0.569	0.004
Rv2850c.4	1	1g50_EST_C_2600 PDB CREDO	0.621	0.155	0.569	0.004
Rv2850c.2	2	2avv_MK1_A_901 PDB CREDO	0.696	0.084	0.568	0.004
Rv2850c.2	2	3ndu_ROC_A_101 PDB CREDO	0.656	0.118	0.568	0.004
Rv2850c.2	11	3ut5_LOC_B_502 PDB CREDO	0.712	0.072	0.568	0.004
Rv2850c.2	11	1ie4_T44_B_328 PDB CREDO	0.729	0.061	0.565	0.004
Rv2850c.2	2	2o4k_DR7_A_301 PDB CREDO	0.659	0.116	0.564	0.004
Rv2850c.4	2	1yi4_ADN_A_306 PDB CREDO	0.563	0.226	0.563	0.004
Rv2850c.4	6	3erd_DES_B_800 PDB CREDO	0.768	0.038	0.562	0.004
Rv2850c.2	11	3rif_IVM_A_403 PDB CREDO	0.624	0.151	0.562	0.004
Rv2850c.2	2	3tkw_017_B_401 PDB CREDO	0.586	0.196	0.561	0.004
Rv2850c.2	2	3k4v_ROC_D_201 PDB CREDO	0.671	0.105	0.561	0.004
Rv2850c.4	2	1qhy_CLM_A_999 PDB CREDO	0.653	0.122	0.560	0.004
Rv2850c.2	11	2y6o_1N1_A_1892 PDB CREDO	0.637	0.138	0.558	0.004
Rv2850c.2	11	3erd_DES_B_800 PDB CREDO	0.619	0.156	0.558	0.004
Rv2850c.2	2	3tkg_ROC_C_901 PDB CREDO	0.650	0.124	0.556	0.005
Rv2850c.3	5	2h77_T3_A_1 PDB CREDO	0.617	0.160	0.556	0.005
Rv2850c.2	11	3ri5_IVM_C_350 PDB CREDO	0.618	0.159	0.556	0.005
Rv2850c.2	11	3rif_IVM_B_403 PDB CREDO	0.618	0.159	0.556	0.005
Rv2850c.4	1	1ere_EST_B_600 PDB CREDO	0.581	0.202	0.556	0.005
Rv2850c.2	11	3rif_IVM_A_402 PDB CREDO	0.616	0.160	0.555	0.005
Rv2850c.2	11	3rif_IVM_D_402 PDB CREDO	0.616	0.160	0.555	0.005
Rv2850c.2	2	3d20_017_A_201 PDB CREDO	0.648	0.126	0.555	0.005
Rv2850c.4	1	1ere_EST_A_600 PDB CREDO	0.580	0.203	0.555	0.005
Rv2850c.4	1	1ere_EST_E_600 PDB CREDO	0.580	0.203	0.555	0.005
Rv2850c.2	2	1sdt_MK1_B_902 PDB CREDO	0.712	0.072	0.554	0.005
Rv2850c.2	2	2avv_MK1_E_902 PDB CREDO	0.678	0.099	0.554	0.005
Rv2850c.4	1	1gwr_EST_A_600 PDB CREDO	0.579	0.205	0.554	0.005
Rv2850c.4	1	1qku_EST_C_600 PDB CREDO	0.579	0.205	0.554	0.005
Rv2850c.2	11	3ria_IVM_C_349 PDB CREDO	0.615	0.162	0.553	0.005
Rv2850c.2	2	3d1z_017_B_201 PDB CREDO	0.693	0.086	0.553	0.005
Rv2850c.4	1	1qku_EST_A_600 PDB CREDO	0.578	0.206	0.553	0.005
Rv2850c.4	1	1qku_EST_B_600 PDB CREDO	0.578	0.206	0.553	0.005
Rv2850c.2	2	3ndw_RIT_A_100 PDB CREDO	0.727	0.062	0.552	0.005
Rv2850c.4	1	1gwr_EST_B_600 PDB CREDO	0.577	0.207	0.552	0.005
Rv2850c.2	2	2hs2_017_A_201 PDB CREDO	0.691	0.087	0.551	0.005
Rv2850c.4	1	1mx1_THA_B_2 PDB CREDO	0.654	0.121	0.550	0.005
Rv2850c.2	11	3v5w_8PR_A_701 PDB CREDO	0.608	0.170	0.550	0.005
Rv2850c.4	1	1pcg_EST_B_2 PDB CREDO	0.575	0.210	0.549	0.005
Rv2850c.2	11	2ity_IRE_A_2020 PDB CREDO	0.737	0.055	0.549	0.005
Rv2850c.2	2	3ogq_AB1_A_200 PDB CREDO	0.779	0.033	0.549	0.005
Rv2850c.2	2	3gp0_NIL_A_1 PDB CREDO	0.819	0.018	0.548	0.005
Rv2850c.3	9	3ret_SAL_A_201 PDB CREDO	0.613	0.163	0.548	0.005
Rv2850c.4	6	2j7y_E3O_A_1454 PDB CREDO	0.668	0.107	0.547	0.005
Rv2850c.2	11	3bbt_FMM_B_91 PDB CREDO	0.679	0.098	0.547	0.005
Rv2850c.2	2	3oxx_DR7_C_100 PDB CREDO	0.720	0.066	0.547	0.005
Rv2850c.4	6	1ere_EST_A_600 PDB CREDO	0.652	0.122	0.547	0.005
Rv2850c.4	6	1ere_EST_E_600 PDB CREDO	0.652	0.122	0.547	0.005
Rv2850c.3	9	3hgx_SAL_A_102 PDB CREDO	0.612	0.165	0.547	0.005
Rv2850c.4	1	1g50_EST_B_1600 PDB CREDO	0.572	0.214	0.546	0.005
Rv2850c.4	6	1ere_EST_B_600 PDB CREDO	0.651	0.123	0.546	0.005
Rv2850c.2	2	3jw2_017_A_401 PDB CREDO	0.684	0.094	0.545	0.005
Rv2850c.2	2	2o4l_TPV_A_403 PDB CREDO	0.622	0.154	0.545	0.005
Rv2850c.4	6	1gwr_EST_B_600 PDB CREDO	0.649	0.125	0.544	0.005
Rv2850c.2	2	2nnk_ROC_A_401 PDB CREDO	0.682	0.095	0.544	0.006
Rv2850c.2	2	3ndt_ROC_D_100 PDB CREDO	0.682	0.096	0.544	0.006
Rv2850c.2	11	1s9p_DES_D_600 PDB CREDO	0.583	0.200	0.544	0.006
Rv2850c.4	6	1g50_EST_B_1600 PDB CREDO	0.648	0.126	0.543	0.006
Rv2850c.2	2	3ndx_RIT_A_100 PDB CREDO	0.665	0.110	0.543	0.006
Rv2850c.4	6	1gwr_EST_A_600 PDB CREDO	0.647	0.127	0.543	0.006
Rv2850c.3	5	2xkw_P1B_B_1475 PDB CREDO	0.560	0.230	0.541	0.006
Rv2850c.4	6	1pcg_EST_B_2 PDB CREDO	0.644	0.131	0.540	0.006
Rv2850c.4	6	1qku_EST_C_600 PDB CREDO	0.643	0.132	0.539	0.006
Rv2850c.3	5	3qt0_486_A_4 PDB CREDO	0.577	0.208	0.538	0.006
Rv2850c.3	5	3oht_1N1_B_1000 PDB CREDO	0.538	0.261	0.538	0.006
Rv2850c.4	6	1qku_EST_B_600 PDB CREDO	0.642	0.133	0.538	0.006
Rv2850c.4	6	1mx1_THA_B_2 PDB CREDO	0.560	0.230	0.537	0.006
Rv2850c.3	5	1bsx_T3_A_1 PDB CREDO	0.637	0.138	0.537	0.006
Rv2850c.3	5	1bsx_T3_B_2 PDB CREDO	0.637	0.138	0.537	0.006
Rv2850c.3	5	3gws_T3_X_500 PDB CREDO	0.637	0.138	0.537	0.006
Rv2850c.4	6	1qku_EST_A_600 PDB CREDO	0.641	0.134	0.537	0.006
Rv2850c.3	5	2h79_T3_A_1 PDB CREDO	0.616	0.160	0.537	0.006
Rv2850c.2	11	2xkw_P1B_B_1475 PDB CREDO	0.597	0.183	0.537	0.006
Rv2850c.4	6	1s9p_DES_B_459 PDB CREDO	0.605	0.172	0.536	0.006
Rv2850c.4	6	1s9p_DES_C_500 PDB CREDO	0.605	0.172	0.536	0.006
Rv2850c.3	9	1uay_ADN_B_1002 PDB CREDO	0.534	0.266	0.534	0.006
Rv2850c.4	2	1qhs_CLM_A_999 PDB CREDO	0.623	0.152	0.534	0.006
Rv2850c.2	11	2itz_IRE_A_2021 PDB CREDO	0.744	0.051	0.533	0.007
Rv2850c.2	2	2aqu_DR7_B_300 PDB CREDO	0.737	0.055	0.533	0.007
Rv2850c.2	2	2avo_MK1_B_902 PDB CREDO	0.718	0.068	0.532	0.007
Rv2850c.2	11	1n49_RIT_D_401 PDB CREDO	0.750	0.048	0.531	0.007
Rv2850c.4	6	3ads_IMN_B_3 PDB CREDO	0.554	0.238	0.531	0.007
Rv2850c.4	1	1dtl_BEP_A_204 PDB CREDO	0.657	0.118	0.531	0.007
Rv2850c.2	2	3oxx_DR7_A_100 PDB CREDO	0.734	0.057	0.531	0.007
Rv2850c.4	2	3fl9_TOP_A_200 PDB CREDO	0.559	0.231	0.530	0.007
Rv2850c.2	11	1mx1_THA_E_5 PDB CREDO	0.609	0.168	0.529	0.007
Rv2850c.2	11	2fum_MIX_A_539 PDB CREDO	0.588	0.194	0.529	0.007
Rv2850c.2	11	3erd_DES_A_600 PDB CREDO	0.588	0.194	0.529	0.007
Rv2850c.3	9	3rem_SAL_B_301 PDB CREDO	0.692	0.087	0.528	0.007
Rv2850c.4	1	2j7y_E3O_A_1454 PDB CREDO	0.730	0.059	0.525	0.007
Rv2850c.2	2	3pwr_ROC_A_401 PDB CREDO	0.674	0.102	0.525	0.007
Rv2850c.2	11	1t7j_478_A_200 PDB CREDO	0.658	0.117	0.524	0.008
Rv2850c.3	5	3uvv_T3_A_501 PDB CREDO	0.642	0.133	0.524	0.008
Rv2850c.2	11	3ads_IMN_B_3 PDB CREDO	0.830	0.015	0.524	0.008
Rv2850c.2	11	2h77_T3_A_1 PDB CREDO	0.541	0.256	0.523	0.008
Rv2850c.4	2	3fl9_TOP_H_200 PDB CREDO	0.580	0.203	0.523	0.008
Rv2850c.2	2	2f80_017_B_301 PDB CREDO	0.706	0.077	0.523	0.008
Rv2850c.3	5	1xzx_T3_X_500 PDB CREDO	0.640	0.135	0.523	0.008
Rv2850c.3	5	2cbr_A80_A_201 PDB CREDO	0.583	0.200	0.523	0.008
Rv2850c.2	11	3lfa_1N1_A_361 PDB CREDO	0.793	0.028	0.523	0.008
Rv2850c.2	2	3bvb_017_B_401 PDB CREDO	0.671	0.105	0.522	0.008
Rv2850c.4	2	3jw5_TOP_A_208 PDB CREDO	0.550	0.243	0.522	0.008
Rv2850c.4	2	3hgx_SAL_A_102 PDB CREDO	0.551	0.242	0.522	0.008
Rv2850c.2	2	3d1y_ROC_A_201 PDB CREDO	0.687	0.091	0.522	0.008
Rv2850c.4	2	3fl9_TOP_B_200 PDB CREDO	0.549	0.245	0.521	0.008
Rv2850c.4	1	3ols_EST_A_600 PDB CREDO	0.644	0.130	0.521	0.008
Rv2850c.2	11	1ie4_T44_A_128 PDB CREDO	0.758	0.044	0.521	0.008
Rv2850c.2	2	3ekw_DR7_B_100 PDB CREDO	0.739	0.054	0.521	0.008
Rv2850c.4	2	3ret_SAL_A_201 PDB CREDO	0.550	0.245	0.521	0.008
Rv2850c.4	2	3ret_SAL_B_201 PDB CREDO	0.550	0.245	0.521	0.008
Rv2850c.4	6	1s9p_DES_D_600 PDB CREDO	0.736	0.056	0.520	0.008
Rv2850c.4	1	3ols_EST_B_600 PDB CREDO	0.643	0.131	0.520	0.008
Rv2850c.2	11	3adx_IMN_B_3 PDB CREDO	0.726	0.062	0.520	0.008
Rv2850c.4	2	3fl9_TOP_G_200 PDB CREDO	0.548	0.247	0.520	0.008
Rv2850c.4	2	2y7j_B49_C_1294 PDB CREDO	0.606	0.172	0.520	0.008
Rv2850c.4	2	2w9g_TOP_A_1159 PDB CREDO	0.548	0.247	0.519	0.008
Rv2850c.4	2	3fl9_TOP_C_200 PDB CREDO	0.519	0.289	0.519	0.008
Rv2850c.4	2	4dt8_ADN_B_401 PDB CREDO	0.519	0.289	0.519	0.008
Rv2850c.2	2	1t7i_017_A_200 PDB CREDO	0.635	0.140	0.518	0.008
Rv2850c.4	2	2w9s_TOP_A_1160 PDB CREDO	0.546	0.249	0.518	0.008
Rv2850c.4	2	3jw5_TOP_B_208 PDB CREDO	0.546	0.249	0.518	0.008
Rv2850c.4	2	3tq8_TOP_A_2001 PDB CREDO	0.546	0.249	0.518	0.008
Rv2850c.2	2	2avs_MK1_B_902 PDB CREDO	0.699	0.082	0.518	0.008
Rv2850c.2	2	1k6c_MK1_B_902 PDB CREDO	0.634	0.141	0.518	0.008
Rv2850c.2	11	3oct_1N1_A_663 PDB CREDO	0.536	0.264	0.518	0.008
Rv2850c.2	11	1qkn_RAL_A_600 PDB CREDO	0.572	0.214	0.518	0.008
Rv2850c.3	9	2bxg_IBP_B_2002 PDB CREDO	0.518	0.291	0.518	0.008
Rv2850c.2	11	2h79_T3_A_1 PDB CREDO	0.553	0.239	0.517	0.008
Rv2850c.2	2	3eky_DR7_A_100 PDB CREDO	0.753	0.046	0.517	0.008
Rv2850c.4	6	1mx1_THA_D_4 PDB CREDO	0.584	0.198	0.517	0.008
Rv2850c.2	2	3el1_DR7_A_100 PDB CREDO	0.733	0.058	0.517	0.008
Rv2850c.2	2	3em4_DR7_V_100 PDB CREDO	0.752	0.047	0.516	0.009
Rv2850c.4	2	3fl9_TOP_D_200 PDB CREDO	0.576	0.209	0.516	0.009
Rv2850c.4	2	3hgx_SAL_B_104 PDB CREDO	0.545	0.251	0.516	0.009
Rv2850c.2	11	3k54_1N1_A_1 PDB CREDO	0.595	0.185	0.516	0.009
Rv2850c.4	2	2w9s_TOP_C_1160 PDB CREDO	0.543	0.253	0.516	0.009
Rv2850c.2	11	3g5d_1N1_B_1 PDB CREDO	0.664	0.111	0.515	0.009
Rv2850c.2	11	3h0a_9RA_A_500 PDB CREDO	0.515	0.295	0.515	0.009
Rv2850c.2	11	2jfa_RAL_A_600 PDB CREDO	0.607	0.171	0.515	0.009
Rv2850c.2	2	1sdu_MK1_B_902 PDB CREDO	0.730	0.059	0.515	0.009
Rv2850c.2	2	3cyw_017_A_201 PDB CREDO	0.630	0.145	0.515	0.009
Rv2850c.3	5	3oht_1N1_A_1000 PDB CREDO	0.574	0.212	0.514	0.009
Rv2850c.2	11	3ria_IVM_E_349 PDB CREDO	0.639	0.136	0.514	0.009
Rv2850c.2	2	1t3r_017_A_1200 PDB CREDO	0.661	0.114	0.514	0.009
Rv2850c.4	1	2yja_EST_B_1550 PDB CREDO	0.636	0.138	0.514	0.009
Rv2850c.2	2	2fxe_DR7_A_102 PDB CREDO	0.748	0.049	0.514	0.009
Rv2850c.2	11	3ri5_IVM_A_349 PDB CREDO	0.638	0.137	0.514	0.009
Rv2850c.3	5	1fm6_BRL_D_503 PDB CREDO	0.513	0.298	0.513	0.009
Rv2850c.3	5	1s9p_DES_A_459 PDB CREDO	0.513	0.298	0.513	0.009
Rv2850c.2	11	3rhw_IVM_A_348 PDB CREDO	0.637	0.137	0.513	0.009
Rv2850c.3	9	3rem_SAL_A_301 PDB CREDO	0.672	0.104	0.513	0.009
Rv2850c.2	11	3qlg_1N1_A_601 PDB CREDO	0.661	0.114	0.513	0.009
Rv2850c.2	11	1lhv_NOG_A_301 PDB CREDO	0.585	0.197	0.513	0.009
Rv2850c.2	2	1hxw_RIT_B_301 PDB CREDO	0.745	0.051	0.512	0.009
Rv2850c.2	2	2r5p_MK1_D_902 PDB CREDO	0.744	0.051	0.511	0.009
Rv2850c.2	11	1ya3_STR_A_1001 PDB CREDO	0.529	0.275	0.511	0.009
Rv2850c.3	9	1yi4_ADN_A_306 PDB CREDO	0.603	0.175	0.511	0.009
Rv2850c.4	2	2w9s_TOP_B_1160 PDB CREDO	0.539	0.260	0.511	0.009
Rv2850c.4	2	3fl9_TOP_F_200 PDB CREDO	0.570	0.217	0.511	0.009
Rv2850c.2	2	2r5p_MK1_B_902 PDB CREDO	0.743	0.052	0.511	0.009
Rv2850c.2	11	3gws_T3_X_500 PDB CREDO	0.564	0.225	0.510	0.009
Rv2850c.2	11	3tkd_CYZ_B_267 PDB CREDO	0.639	0.135	0.510	0.009
Rv2850c.2	2	1hxb_ROC_A_100 PDB CREDO	0.688	0.090	0.510	0.009
Rv2850c.4	6	1mx1_THA_F_6 PDB CREDO	0.576	0.209	0.510	0.009
Rv2850c.3	5	2prg_BRL_A_1 PDB CREDO	0.509	0.304	0.509	0.009
Rv2850c.4	2	3fre_TOP_X_300 PDB CREDO	0.638	0.136	0.509	0.009
Rv2850c.4	6	3erd_DES_A_600 PDB CREDO	0.695	0.085	0.509	0.009
Rv2850c.2	11	1zgy_BRL_A_503 PDB CREDO	0.527	0.278	0.509	0.009
Rv2850c.2	2	3s43_478_A_401 PDB CREDO	0.669	0.106	0.509	0.010
Rv2850c.4	1	3uud_EST_A_600 PDB CREDO	0.629	0.146	0.509	0.010
Rv2850c.2	11	3g5d_1N1_A_1 PDB CREDO	0.656	0.119	0.508	0.010
Rv2850c.2	11	3jwq_VIA_D_901 PDB CREDO	0.508	0.305	0.508	0.010
Rv2850c.2	2	2nnp_ROC_A_401 PDB CREDO	0.622	0.154	0.508	0.010
Rv2850c.2	11	3qlg_1N1_B_601 PDB CREDO	0.655	0.119	0.508	0.010
Rv2850c.4	2	1fb7_ROC_A_100 PDB CREDO	0.567	0.221	0.508	0.010
Rv2850c.2	2	3nuj_478_B_401 PDB CREDO	0.685	0.093	0.508	0.010
Rv2850c.2	11	1hwi_115_A_2 PDB CREDO	0.542	0.255	0.507	0.010
Rv2850c.4	6	1sn5_T3_C_601 PDB CREDO	0.507	0.307	0.507	0.010
Rv2850c.2	2	1hsh_MK1_A_401 PDB CREDO	0.799	0.025	0.507	0.010
Rv2850c.4	1	3uud_EST_B_600 PDB CREDO	0.627	0.148	0.507	0.010
Rv2850c.2	11	2h42_VIA_A_901 PDB CREDO	0.507	0.308	0.507	0.010
Rv2850c.2	11	1xzx_T3_X_500 PDB CREDO	0.578	0.206	0.506	0.010
Rv2850c.3	5	1s9p_DES_D_600 PDB CREDO	0.506	0.309	0.506	0.010
Rv2850c.2	11	3u7s_017_A_201 PDB CREDO	0.523	0.283	0.506	0.010
Rv2850c.4	6	1sn0_T44_C_601 PDB CREDO	0.576	0.209	0.505	0.010
Rv2850c.4	1	1g50_EST_A_600 PDB CREDO	0.625	0.150	0.505	0.010
Rv2850c.4	2	3fl9_TOP_E_200 PDB CREDO	0.563	0.225	0.505	0.010
Rv2850c.2	11	1bsx_T3_A_1 PDB CREDO	0.558	0.233	0.504	0.010
Rv2850c.4	1	3vkx_T3_A_301 PDB CREDO	0.580	0.204	0.504	0.010
Rv2850c.2	11	3hec_STI_A_1 PDB CREDO	0.594	0.186	0.504	0.010
Rv2850c.2	11	1bsx_T3_B_2 PDB CREDO	0.557	0.234	0.504	0.010
Rv2850c.2	11	3ria_IVM_C_350 PDB CREDO	0.626	0.150	0.504	0.010
Rv2850c.2	11	3rhw_IVM_B_349 PDB CREDO	0.625	0.151	0.503	0.010
Rv2850c.2	11	3ri5_IVM_B_349 PDB CREDO	0.625	0.151	0.503	0.010
Rv2850c.2	11	3ria_IVM_A_348 PDB CREDO	0.625	0.151	0.503	0.010
Rv2850c.2	11	3rif_IVM_E_402 PDB CREDO	0.625	0.151	0.503	0.010
Rv2850c.3	5	3erd_DES_A_600 PDB CREDO	0.521	0.285	0.503	0.010
Rv2850c.4	6	3hm1_J3Z_A_2 PDB CREDO	0.599	0.180	0.503	0.010
Rv2850c.2	11	3rhw_IVM_B_348 PDB CREDO	0.624	0.151	0.503	0.010
Rv2850c.2	11	3ri5_IVM_D_349 PDB CREDO	0.624	0.151	0.503	0.010
Rv2850c.2	11	2jfa_RAL_B_600 PDB CREDO	0.611	0.166	0.502	0.011
Rv2850c.2	11	2zva_1N1_A_513 PDB CREDO	0.674	0.102	0.502	0.011
Rv2850c.2	11	3qt0_486_A_4 PDB CREDO	0.502	0.315	0.502	0.011
Rv2850c.2	11	3rhw_IVM_D_348 PDB CREDO	0.623	0.152	0.502	0.011
Rv2850c.2	11	1ya3_STR_B_2001 PDB CREDO	0.519	0.289	0.501	0.011
Rv2850c.2	11	3rhw_IVM_D_349 PDB CREDO	0.623	0.153	0.501	0.011
Rv2850c.2	11	3ria_IVM_E_348 PDB CREDO	0.623	0.153	0.501	0.011
Rv2850c.3	5	3ln1_CEL_D_682 PDB CREDO	0.538	0.262	0.501	0.011
Rv2850c.4	2	2eva_ADN_A_498 PDB CREDO	0.585	0.198	0.501	0.011
Rv2850c.2	2	3ekv_478_A_200 PDB CREDO	0.711	0.073	0.501	0.011
Rv2850c.4	6	1mx1_THA_E_5 PDB CREDO	0.660	0.115	0.501	0.011
Rv2850c.2	2	2qak_1UN_A_1001 PDB CREDO	0.675	0.101	0.501	0.011
Rv2850c.2	2	4dqf_017_B_101 PDB CREDO	0.710	0.073	0.501	0.011
Rv2850c.2	11	1err_RAL_A_600 PDB CREDO	0.608	0.169	0.500	0.011
Rv2850c.2	11	3ols_EST_A_600 PDB CREDO	0.699	0.082	0.500	0.011
Rv2850c.2	11	3ols_EST_B_600 PDB CREDO	0.699	0.082	0.500	0.011
Rv2850c.2	11	3heg_BAX_A_1 PDB CREDO	0.646	0.128	0.500	0.011

Similarity to known drug target from sensitive sequence analysis

No drug targets

List of small molecules tested from TIBLE

Data not available

Off-target activity - ligand based from TIBLE

Data not available

Small molecules involved in protein-protein complex from TIMBAL .Proteins similar to Mtb based on sequence analysis.

Data not available

STITCH interactions

Chemical Name	Confidence score	Molecular Weight
protoporphyrinPubChem	0.972	562.658
chlorophyllPubChem	0.738	895.505