SInCRe - Rv1314c

Tuberculist information

Gene name	Rv1314c
Protein function	Conserved protein
Functional category(tuberculist)	conserved hypotheticals
Gene location(kb)	1469.67
Molecular mass(da)	20694.4
External sites	TB Database TubercuList WebTB

Protein sequence

Number of amino acids : 193

	  		  	1    MAVHLTRIYTRTGDDGTTGLSDMSRVAKTDARLVAYADCDEANAAIGAALALGHPDTQIT   60
			  	61   DVLRQIQNDLFDAGADLSTPIVENPKHPPLRIAQSYIDRLEGWCDAYNAGLPALKSFVLP  120
			  	121  GGSPLSALLHVARTVVRRAERSAWAAVDAHPEGVSVLPAKYLNRLSDLLFILSRVANPDG  180
			  	181  DVLWRPGGDRTAS

Known structures in the PDB

	PDB ID	2G2D
	Total residue count	193
	Number of chains	1
	Method	X-RAY
	Resolution	2

Number of amino acids : 193

Domains assigned based on sequence.

Mtb Structural proteome models

CHOPIN models

Profile-based domain assignment

Structural/Functional domain family	Pfam acc.no./SCOP ID	Domain Region
Cob_adeno_trans	PF01923	8-177

Mtb Structural Proteome models

Model Number	1
Model name	Rv1314c_2g2d_A
Template	2G2D APDB CREDO
Template coverage	29_188
Template Identity(%)	100.0
Model coverage(%)	82.4
Normalized DOPE score	-2.023

Model Number	2
Model name	Rv1314c
Template	2G2D APDB CREDO
Template coverage	29_188
Template Identity(%)	100.0
Model coverage(%)	82.4
Normalized DOPE score	-1.805

Structure Models from Chopin

Model Number	1
Profile	1.20.1200.10 Click for model details
zscore	39.57
Residue begin	5
Residue end	193

Binding pockets

STRING

Cytoscape Web will replace the contents of this div with protein-protein interaction network.

Protein interacting with Rv1314c	Gene name	Confidence Score
Rv2848c	cobB	0.904
Rv2848c	cobB	0.904

Potential ligand/drug binding sites

Protein Model	Pocket Number	Drug Binding Site	PMIN Score	Pvalue PMIN	PMAX Score	Pvalue PMAX
Rv1314c_2g2d_A	5	2itz_IRE_A_2021 PDB CREDO	0.522	0.285	0.522	0.008
Rv1314c_2g2d_A	5	3sxr_1N1_B_2 PDB CREDO	0.514	0.296	0.514	0.009
Rv1314c_2g2d_A	5	1fmo_ADN_E_351 PDB CREDO	0.508	0.306	0.508	0.010
Rv1314c_2g2d_A	5	2uxo_TAC_B_1211 PDB CREDO	0.504	0.313	0.504	0.010
Rv1314c_2g2d_A	5	3kw2_ADN_A_300 PDB CREDO	0.588	0.194	0.503	0.010
Rv1314c_2g2d_A	5	3g0e_B49_A_9000 PDB CREDO	0.501	0.316	0.501	0.011
Rv1314c_2g2d_A	5	3kw2_ADN_B_300 PDB CREDO	0.521	0.286	0.500	0.011

Similarity to known drug target from sensitive sequence analysis

No drug targets

List of small molecules tested from TIBLE

Data not available

Off-target activity - ligand based from TIBLE

Data not available

Small molecules involved in protein-protein complex from TIMBAL .Proteins similar to Mtb based on sequence analysis.

Data not available

STITCH interactions

Chemical Name	Confidence score	Molecular Weight
magnesiumPubChem	0.838	24.305
adenosine triphosphatePubChem	0.798	507.181
selenomethioninePubChem	0.797	196.106
SeMetPubChem	0.797	196.106
cob(II)alaminPubChem	0.796	1332.37
adenosylcobalaminPubChem	0.783	1580.59
AdoCblPubChem	0.766	1579.58
glycerolPubChem	0.756	92.0938
chloridePubChem	0.713	35.453
sulfatePubChem	0.713	96.0626
hydron sulfatePubChem	0.713	196.157
dioxanePubChem	0.708	88.1051