SInCRe - Rv2072c

Tuberculist information

Gene name	cobL
Protein function	Precorrin-6Y C(5,15)-methyltransferase (decarboxylating) CobL
Functional category(tuberculist)	intermediary metabolism and respiration
Gene location(kb)	2328.97
Molecular mass(da)	41854.4
External sites	TB Database TubercuList WebTB

Protein sequence

Number of amino acids : 390

	  		  	1    MIIVVGIGADGMTGLSEHSRSELRRATVIYGSKRQLALLDDTVTAERWEWPTPMLPAVQG   60
			  	61   LSPDGADLHVVASGDPLLHGIGSTLIRLFGHDNVTVLPHVSAVTLACARMGWNVYDTEVI  120
			  	121  SLVTAQPHTAVRRGGRAIVLSGDRSTPQALAVLLTEHGRGDSKFSVLEQLGGPAERRRDG  180
			  	181  TARAWACDPPLDVDELNVIAVRYLLDERTSWAPDEAFAHDGQITKHPIRVLTLAALAPRP  240
			  	241  GQRLWDVGAGSGAIAVQWCRSWPGCTAVAFERDERRRRNIGFNAAAFGVSVDVRGDAPDA  300
			  	301  FDDAARPSVIFLGGGVTQPGLLEACLDSLPAGGNLVANAVTVESEAALAHAYSRLGGELR  360
			  	361  RFQHYLGEPLGGFTGWRPQLPVTQWSVTKR

Known structures in the PDB

No Known structures

Number of amino acids : 390

Domains assigned based on sequence.

Mtb Structural proteome models

CHOPIN models

Profile-based domain assignment

Structural/Functional domain family	Pfam acc.no./SCOP ID	Domain Region
TP_methylase	PF00590	1-186
Methyltransf_18	PF12847	240-340

Mtb Structural Proteome models

Model Number	1
Model name	Rv2072c.3
Template	1L3I APDB CREDO
Template coverage	19_182
Template Identity(%)	21.9
Model coverage(%)	40.8
Normalized DOPE score	-0.234

Model Number	2
Model name	Rv2072c
Template	2BB3 APDB CREDO
Template coverage	1_177
Template Identity(%)	27.7
Model coverage(%)	46.4
Normalized DOPE score	0.215

Structure Models from Chopin

Model Number	1
Profile	c.66.1.22 - 3.40.50.150 Click for model details
zscore	34.84
Residue begin	211
Residue end	389

Model Number	2
Profile	c.90.1.1 Click for model details
zscore	10.18
Residue begin	1
Residue end	382

Model Number	3
Profile	a.79.1.3, c.66.1.38 - 1.10.287.730, 1.10.940.10, 3.30.70.1170, 3.40.50.150 Click for model details
zscore	9.45
Residue begin	10
Residue end	389

Binding pockets

STRING

Cytoscape Web will replace the contents of this div with protein-protein interaction network.

Protein interacting with Rv2072c	Gene name	Confidence Score
Rv2070c	cobK	0.999
Rv2065	cobH	0.997
Rv2071c	cobM	0.996
Rv2066	cobI	0.98
Rv2848c	cobB	0.929
Rv2848c	cobB	0.929
Rv0255c	cobQ1	0.907
Rv0255c	cobQ1	0.907

Potential ligand/drug binding sites

Protein Model	Pocket Number	Drug Binding Site	PMIN Score	Pvalue PMIN	PMAX Score	Pvalue PMAX
Rv2072c.3	8	3r9c_ECL_A_451 PDB CREDO	0.725	0.063	0.617	0.002
Rv2072c.3	8	3ozk_T44_A_128 PDB CREDO	0.594	0.187	0.594	0.002
Rv2072c.3	8	3a2q_ACA_A_601 PDB CREDO	0.654	0.120	0.583	0.003
Rv2072c.3	8	3ijx_HCZ_D_800 PDB CREDO	0.546	0.250	0.546	0.005
Rv2072c.3	8	3re0_CPT_B_201 PDB CREDO	0.791	0.028	0.546	0.005
Rv2072c.3	8	3o0q_ADN_A_1004 PDB CREDO	0.575	0.211	0.544	0.006
Rv2072c.3	8	3o0q_ADN_B_1004 PDB CREDO	0.575	0.211	0.544	0.006
Rv2072c.3	8	3mdt_VOR_B_506 PDB CREDO	0.603	0.175	0.541	0.006
Rv2072c.3	8	1lik_ADN_A_799 PDB CREDO	0.568	0.219	0.537	0.006
Rv2072c.3	8	1tz8_DES_B_128 PDB CREDO	0.559	0.232	0.529	0.007
Rv2072c.3	8	3mdt_VOR_A_506 PDB CREDO	0.583	0.201	0.522	0.008
Rv2072c.3	8	2wd9_IBP_A_1570 PDB CREDO	0.661	0.114	0.521	0.008
Rv2072c.3	9	2xfs_J01_B_500 PDB CREDO	0.551	0.243	0.516	0.009
Rv2072c.3	9	2xf3_J01_B_500 PDB CREDO	0.548	0.246	0.514	0.009
Rv2072c.3	9	2xfs_J01_A_500 PDB CREDO	0.542	0.255	0.508	0.010
Rv2072c.3	8	3c9j_308_B_101 PDB CREDO	0.786	0.030	0.506	0.010
Rv2072c.3	9	1e7b_HLT_B_4003 PDB CREDO	0.574	0.212	0.501	0.011

Similarity to known drug target from sensitive sequence analysis

No drug targets

List of small molecules tested from TIBLE

Data not available

Off-target activity - ligand based from TIBLE

Data not available

Small molecules involved in protein-protein complex from TIMBAL .Proteins similar to Mtb based on sequence analysis.

Data not available

STITCH interactions

Chemical Name	Confidence score	Molecular Weight
precorrin-6xPubChem	0.9	887.861
Precorrin 6bPubChem	0.9	896.933
NADPPubChem	0.9	744.413
CPD-687PubChem	0.9	880.976
S-adenosyl-L-methioninePubChem	0.9	399.445
hydrogenobyrinic acidPubChem	0.9	880.976
Precorrin 6aPubChem	0.9	894.917
S-adenosylhomocysteinePubChem	0.9	384.411
precorrin-8xPubChem	0.9	880.976
H(+)PubChem	0.9	2.01588
deuteriumPubChem	0.9	2.01588
protiumPubChem	0.9	2.01576
NADP(H)PubChem	0.9	745.421
S-adenosyl-methioninePubChem	0.9	398.437
COJPubChem	0.9	880.976
Precorrin 8xPubChem	0.9	880.976
precorrin-6yPubChem	0.9	896.933
carbon dioxidePubChem	0.9	44.0095