SInCRe - Rv3610c

Tuberculist information

Gene name	ftsH
Protein function	Membrane-bound protease FtsH (cell division protein)
Functional category(tuberculist)	cell wall and cell processes
Gene location(kb)	4050.6
Molecular mass(da)	81985.5
External sites	TB Database TubercuList WebTB

Protein sequence

Number of amino acids : 760

	  		  	1    MNRKNVTRTITAIAVVVLLGWSFFYFSDDTRGYKPVDTSVAITQINGDNVKSAQIDDREQ   60
			  	61   QLRLILKKGNNETDGSEKVITKYPTGYAVDLFNALSAKNAKVSTVVNQGSILGELLVYVL  120
			  	121  PLLLLVGLFVMFSRMQGGARMGFGFGKSRAKQLSKDMPKTTFADVAGVDEAVEELYEIKD  180
			  	181  FLQNPSRYQALGAKIPKGVLLYGPPGTGKTLLARAVAGEAGVPFFTISGSDFVEMFVGVG  240
			  	241  ASRVRDLFEQAKQNSPCIIFVDEIDAVGRQRGAGLGGGHDEREQTLNQLLVEMDGFGDRA  300
			  	301  GVILIAATNRPDILDPALLRPGRFDRQIPVSNPDLAGRRAVLRVHSKGKPMAADADLDGL  360
			  	361  AKRTVGMTGADLANVINEAALLTARENGTVITGPALEEAVDRVIGGPRRKGRIISEQEKK  420
			  	421  ITAYHEGGHTLAAWAMPDIEPIYKVTILARGRTGGHAVAVPEEDKGLRTRSEMIAQLVFA  480
			  	481  MGGRAAEELVFREPTTGAVSDIEQATKIARSMVTEFGMSSKLGAVKYGSEHGDPFLGRTM  540
			  	541  GTQPDYSHEVAREIDEEVRKLIEAAHTEAWEILTEYRDVLDTLAGELLEKETLHRPELES  600
			  	601  IFADVEKRPRLTMFDDFGGRIPSDKPPIKTPGELAIERGEPWPQPVPEPAFKAAIAQATQ  660
			  	661  AAEAARSDAGQTGHGANGSPAGTHRSGDRQYGSTQPDYGAPAGWHAPGWPPRSSHRPSYS  720
			  	721  GEPAPTYPGQPYPTGQADPGSDESSAEQDDEVSRTKPAHG

Known structures in the PDB

No Known structures

Number of amino acids : 760

Domains assigned based on sequence.

Mtb Structural proteome models

CHOPIN models

Profile-based domain assignment

Structural/Functional domain family	Pfam acc.no./SCOP ID	Domain Region
FtsH_ext	PF06480	18-103
AAA	PF00004	199-332
Peptidase_M41	PF01434	392-601

Mtb Structural Proteome models

Model Number	1
Model name	Rv3610c
Template	2DHR APDB CREDO
Template coverage	143_600
Template Identity(%)	56.3
Model coverage(%)	60.8
Normalized DOPE score	-0.253

Model Number	2
Model name	Rv3610c.1
Template	1YPW APDB CREDO
Template coverage	33_734
Template Identity(%)	20.4
Model coverage(%)	78.4
Normalized DOPE score	1.301

Structure Models from Chopin

Model Number	1
Profile	a.269.1.1, c.37.1.20 Click for model details
zscore	89.32
Residue begin	152
Residue end	607

Model Number	2
Profile	a.269.1.1 Click for model details
zscore	42.98
Residue begin	413
Residue end	614

Model Number	3
Profile	b.52.2.3, c.37.1.20, d.31.1.1 - 1.10.8.60, 2.40.40.20, 3.10.330.10, 3.40.50.300 Click for model details
zscore	32.2
Residue begin	5
Residue end	402

Model Number	4
Profile	c.37.1.20 Click for model details
zscore	11.98
Residue begin	77
Residue end	507

Binding pockets

STRING

Cytoscape Web will replace the contents of this div with protein-protein interaction network.

Protein interacting with Rv3610c	Gene name	Confidence Score
Rv3608c	folP1	0.98
Rv2461c	clpP1	0.968
Rv2150c	ftsZ	0.966
Rv2150c	ftsZ	0.966
Rv2555c	alaS	0.963
Rv2555c	alaS	0.963
Rv2555c	alaS	0.963
Rv2457c	clpX	0.962
Rv2457c	clpX	0.962
Rv2457c	clpX	0.962
Rv3596c	clpC1	0.952
Rv3596c	clpC1	0.952
Rv3596c	clpC1	0.952
Rv3596c	clpC1	0.952
Rv3596c	clpC1	0.952
Rv1638	uvrA	0.951
Rv3609c	folE	0.943
Rv0001	dnaA	0.941
Rv2592c	ruvB	0.941
Rv0001	dnaA	0.941
Rv2592c	ruvB	0.941
Rv0350	dnaK	0.934
Rv0732	secY	0.933
Rv2299c	htpG	0.927
Rv3598c	lysS	0.927
Rv3598c	lysS	0.927
Rv2299c	htpG	0.927
Rv3240c	secA1	0.926
Rv3240c	secA1	0.926
Rv3240c	secA1	0.926
Rv2921c	ftsY	0.925
Rv2921c	ftsY	0.925
Rv3846	sodA	0.914
Rv3846	sodA	0.914
Rv0384c	clpB	0.912
Rv0384c	clpB	0.912
Rv0384c	clpB	0.912
Rv0384c	clpB	0.912
Rv3417c	groEL1	0.905
Rv3606c	folK	0.905

Potential ligand/drug binding sites

Protein Model	Pocket Number	Drug Binding Site	PMIN Score	Pvalue PMIN	PMAX Score	Pvalue PMAX
Rv3610c.1	8	3sxr_1N1_B_2 PDB CREDO	0.620	0.156	0.620	0.001
Rv3610c.1	8	3sxr_1N1_A_1 PDB CREDO	0.625	0.150	0.601	0.002
Rv3610c.1	8	3kw2_ADN_B_300 PDB CREDO	0.622	0.154	0.598	0.002
Rv3610c.1	8	2xn7_T44_A_1355 PDB CREDO	0.579	0.205	0.579	0.003
Rv3610c.1	8	2xn6_T44_A_1370 PDB CREDO	0.576	0.210	0.576	0.003
Rv3610c.1	8	2xn5_FUN_A_1356 PDB CREDO	0.571	0.216	0.571	0.004
Rv3610c.1	8	2uxo_TAC_B_1211 PDB CREDO	0.566	0.222	0.566	0.004
Rv3610c.1	8	3kw2_ADN_A_300 PDB CREDO	0.660	0.115	0.565	0.004
Rv3610c.1	8	3g0e_B49_A_9000 PDB CREDO	0.562	0.227	0.562	0.004
Rv3610c.1	8	3fuu_ADN_A_0 PDB CREDO	0.603	0.175	0.557	0.004
Rv3610c.1	33	1t46_STI_A_3 PDB CREDO	0.554	0.238	0.554	0.005
Rv3610c.1	8	3k2h_LYA_A_514 PDB CREDO	0.600	0.179	0.554	0.005
Rv3610c.1	8	3adx_IMN_B_3 PDB CREDO	0.553	0.239	0.553	0.005
Rv3610c.1	8	2riw_T44_A_1395 PDB CREDO	0.586	0.196	0.540	0.006
Rv3610c.1	8	1fj8_CER_B_500 PDB CREDO	0.582	0.201	0.536	0.006
Rv3610c.1	8	1fj8_CER_D_500 PDB CREDO	0.582	0.201	0.536	0.006
Rv3610c.1	8	2o7o_DXT_A_222 PDB CREDO	0.536	0.263	0.536	0.006
Rv3610c.1	55	3r9c_ECL_A_452 PDB CREDO	0.582	0.202	0.536	0.006
Rv3610c.1	8	1m17_AQ4_A_999 PDB CREDO	0.555	0.237	0.533	0.007
Rv3610c.1	8	2trt_TAC_A_222 PDB CREDO	0.533	0.268	0.533	0.007
Rv3610c.1	8	2w9s_TOP_D_1158 PDB CREDO	0.578	0.206	0.532	0.007
Rv3610c.1	33	1xkk_FMM_A_91 PDB CREDO	0.559	0.232	0.530	0.007
Rv3610c.1	8	2w8y_NDR_B_1000 PDB CREDO	0.552	0.241	0.530	0.007
Rv3610c.1	8	3nrr_D16_B_530 PDB CREDO	0.530	0.273	0.530	0.007
Rv3610c.1	8	2ceo_T44_A_1395 PDB CREDO	0.626	0.149	0.529	0.007
Rv3610c.1	8	1fj8_CER_C_500 PDB CREDO	0.574	0.212	0.528	0.007
Rv3610c.1	8	2ceo_T44_B_1395 PDB CREDO	0.625	0.150	0.528	0.007
Rv3610c.1	33	1uwj_BAX_A_1723 PDB CREDO	0.605	0.173	0.528	0.007
Rv3610c.1	8	1uho_VDN_A_1000 PDB CREDO	0.571	0.216	0.526	0.007
Rv3610c.1	8	3ri5_IVM_E_349 PDB CREDO	0.547	0.248	0.525	0.007
Rv3610c.1	8	1ie4_T44_A_128 PDB CREDO	0.547	0.249	0.525	0.007
Rv3610c.1	8	1uof_PNN_A_1312 PDB CREDO	0.522	0.284	0.522	0.008
Rv3610c.1	8	4agd_B49_A_2000 PDB CREDO	0.567	0.220	0.522	0.008
Rv3610c.1	8	3g5d_1N1_B_1 PDB CREDO	0.565	0.224	0.522	0.008
Rv3610c.1	8	1fj8_CER_A_500 PDB CREDO	0.566	0.221	0.522	0.008
Rv3610c.1	8	1wu8_ADN_B_501 PDB CREDO	0.566	0.221	0.522	0.008
Rv3610c.1	8	2itz_IRE_A_2021 PDB CREDO	0.522	0.285	0.522	0.008
Rv3610c.1	48	1v8b_ADN_D_3502 PDB CREDO	0.568	0.219	0.521	0.008
Rv3610c.1	8	1jg3_ADN_B_550 PDB CREDO	0.564	0.225	0.521	0.008
Rv3610c.1	8	2ayl_FLP_B_2701 PDB CREDO	0.543	0.255	0.521	0.008
Rv3610c.1	8	3ls4_TCI_H_220 PDB CREDO	0.542	0.255	0.521	0.008
Rv3610c.1	8	1a27_EST_A_350 PDB CREDO	0.562	0.227	0.520	0.008
Rv3610c.1	8	3g5d_1N1_A_1 PDB CREDO	0.562	0.228	0.519	0.008
Rv3610c.1	8	3mdv_CL6_A_506 PDB CREDO	0.671	0.105	0.518	0.008
Rv3610c.1	33	3gp0_NIL_A_1 PDB CREDO	0.532	0.270	0.518	0.008
Rv3610c.1	8	3qlg_1N1_A_601 PDB CREDO	0.561	0.229	0.518	0.008
Rv3610c.1	8	1s9p_DES_B_459 PDB CREDO	0.539	0.260	0.518	0.008
Rv3610c.1	8	2bxf_DZP_B_2001 PDB CREDO	0.670	0.105	0.518	0.008
Rv3610c.1	16	3dd0_EZL_A_301 PDB CREDO	0.517	0.292	0.517	0.008
Rv3610c.1	48	1v8b_ADN_B_1502 PDB CREDO	0.563	0.226	0.517	0.008
Rv3610c.1	8	3axz_ADN_A_401 PDB CREDO	0.612	0.165	0.517	0.008
Rv3610c.1	8	1fmo_ADN_E_351 PDB CREDO	0.516	0.294	0.516	0.009
Rv3610c.1	8	2bxf_DZP_A_2001 PDB CREDO	0.668	0.107	0.516	0.009
Rv3610c.1	8	1s9p_DES_C_500 PDB CREDO	0.536	0.263	0.515	0.009
Rv3610c.1	8	3k54_1N1_A_1 PDB CREDO	0.624	0.152	0.514	0.009
Rv3610c.1	19	4da6_GA2_A_301 PDB CREDO	0.542	0.255	0.514	0.009
Rv3610c.1	16	2ceo_T44_A_1395 PDB CREDO	0.562	0.227	0.514	0.009
Rv3610c.1	8	1ie4_T44_B_328 PDB CREDO	0.556	0.236	0.514	0.009
Rv3610c.1	19	1z37_ADN_A_300 PDB CREDO	0.541	0.257	0.513	0.009
Rv3610c.1	8	3n8z_FLP_B_1701 PDB CREDO	0.513	0.299	0.513	0.009
Rv3610c.1	16	3dcw_EZL_A_301 PDB CREDO	0.512	0.300	0.512	0.009
Rv3610c.1	8	3vri_1KX_A_301 PDB CREDO	0.532	0.269	0.511	0.009
Rv3610c.1	16	2ceo_T44_B_1395 PDB CREDO	0.559	0.231	0.511	0.009
Rv3610c.1	8	1ict_T44_C_128 PDB CREDO	0.532	0.269	0.511	0.009
Rv3610c.1	8	1pbc_BHA_A_396 PDB CREDO	0.632	0.142	0.511	0.009
Rv3610c.1	8	3nrr_D16_A_520 PDB CREDO	0.605	0.173	0.511	0.009
Rv3610c.1	8	3nt1_NPS_B_4 PDB CREDO	0.511	0.301	0.511	0.009
Rv3610c.1	16	3caj_EZL_A_265 PDB CREDO	0.511	0.302	0.511	0.009
Rv3610c.1	8	2ydo_ADN_A_400 PDB CREDO	0.604	0.174	0.510	0.009
Rv3610c.1	8	3qlg_1N1_B_601 PDB CREDO	0.552	0.241	0.510	0.009
Rv3610c.1	8	1z9y_FUN_A_500 PDB CREDO	0.573	0.213	0.509	0.009
Rv3610c.1	8	3oct_1N1_A_663 PDB CREDO	0.687	0.091	0.509	0.009
Rv3610c.1	8	3jwq_VIA_B_901 PDB CREDO	0.640	0.134	0.509	0.009
Rv3610c.1	8	1udu_CIA_B_2003 PDB CREDO	0.576	0.209	0.509	0.010
Rv3610c.1	8	3r9c_ECL_A_452 PDB CREDO	0.552	0.241	0.509	0.010
Rv3610c.1	55	2itz_IRE_A_2021 PDB CREDO	0.509	0.305	0.509	0.010
Rv3610c.1	48	1v8b_ADN_C_2502 PDB CREDO	0.626	0.149	0.508	0.010
Rv3610c.1	8	3nt1_NPS_A_5 PDB CREDO	0.508	0.306	0.508	0.010
Rv3610c.1	33	2xkw_P1B_A_1478 PDB CREDO	0.548	0.247	0.507	0.010
Rv3610c.1	8	2xrl_DXT_A_1211 PDB CREDO	0.574	0.212	0.506	0.010
Rv3610c.1	8	3bbt_FMM_B_91 PDB CREDO	0.567	0.220	0.504	0.010
Rv3610c.1	8	3ri5_IVM_B_349 PDB CREDO	0.567	0.220	0.504	0.010
Rv3610c.1	8	2ity_IRE_A_2020 PDB CREDO	0.525	0.280	0.504	0.010
Rv3610c.1	8	2bxg_IBP_B_2001 PDB CREDO	0.571	0.216	0.504	0.010
Rv3610c.1	8	3ri5_IVM_D_349 PDB CREDO	0.567	0.221	0.504	0.010
Rv3610c.1	8	3rhw_IVM_B_349 PDB CREDO	0.566	0.222	0.503	0.010
Rv3610c.1	55	1d4f_ADN_A_601 PDB CREDO	0.523	0.283	0.503	0.010
Rv3610c.1	8	3f4x_KLT_A_300 PDB CREDO	0.565	0.224	0.502	0.011
Rv3610c.1	16	1dmy_AZM_B_900 PDB CREDO	0.502	0.315	0.502	0.011
Rv3610c.1	8	3k2h_LYA_B_514 PDB CREDO	0.654	0.121	0.502	0.011
Rv3610c.1	8	1ya3_STR_C_3001 PDB CREDO	0.608	0.169	0.502	0.011
Rv3610c.1	8	1xp0_VDN_A_201 PDB CREDO	0.568	0.219	0.501	0.011
Rv3610c.1	8	3ads_IMN_B_3 PDB CREDO	0.568	0.219	0.501	0.011
Rv3610c.1	8	3sv8_SV6_A_1 PDB CREDO	0.522	0.284	0.501	0.011
Rv3610c.1	8	3ti1_B49_A_299 PDB CREDO	0.542	0.255	0.501	0.011
Rv3610c.1	8	3rhw_IVM_B_348 PDB CREDO	0.563	0.226	0.501	0.011
Rv3610c.1	8	3rhw_IVM_D_349 PDB CREDO	0.563	0.226	0.501	0.011
Rv3610c.1	48	1v8b_ADN_A_502 PDB CREDO	0.523	0.283	0.500	0.011
Rv3610c.1	16	3ubo_ADN_A_353 PDB CREDO	0.572	0.214	0.500	0.011
Rv3610c.1	8	3pgh_FLP_D_701 PDB CREDO	0.567	0.221	0.500	0.011
Rv3610c.1	33	3cs9_NIL_D_600 PDB CREDO	0.500	0.318	0.500	0.011

Similarity to known drug target from sensitive sequence analysis

No drug targets

List of small molecules tested from TIBLE

Data not available

Off-target activity - ligand based from TIBLE

Data not available

Small molecules involved in protein-protein complex from TIMBAL .Proteins similar to Mtb based on sequence analysis.

Data not available

STITCH interactions

Chemical Name	Confidence score	Molecular Weight
adenosine diphosphatePubChem	0.789	427.201
zincPubChem	0.734	65.409
hydron sulfatePubChem	0.728	196.157
sulfatePubChem	0.728	96.0626
mercuryPubChem	0.725	200.59