SInCRe - Rv0271c

Tuberculist information

Gene name	fadE6
Protein function	Probable acyl-CoA dehydrogenase FadE6
Functional category(tuberculist)	lipid metabolism
Gene location(kb)	326.266
Molecular mass(da)	78477.2
External sites	TB Database TubercuList WebTB

Protein sequence

Number of amino acids : 731

	  		  	1    MSIAITPEHYELADSVRSLVARVAPSEVLHAALESPVENPPPYWQAAAEQGLQGVHLAES   60
			  	61   VGGQGFGILELAVVLAEFGYGAVPGPFVPSAIASALIAAHDPQAKVLAELATGAAIAAYA  120
			  	121  LDSGLTATRHGDVLVIRGEVRAVPAAAQASVLVLPVAIESRDEWVVLRNDQLEIEAVKSL  180
			  	181  DPLRPIAHVRANAVDVSDDALLSNLTMTTAHALMSTLLSAEAVGVARWATDTASAYAKIR  240
			  	241  EQFGRPIGQFQAIKHKCAEMIADTERATAAVWDAARALDDAGESSSDVEFAAAVAATLAP  300
			  	301  ATAQRCTQDCIQVHGGIGFTWEHDTNVYYRRALMLAACFGRGSEYPQRVVDTATTAGMRP  360
			  	361  VDIDLDPSTEKLRAQIRAEVAALKAMPREPRTVAIAEGGWVLPYLPKPWGRAASPVEQII  420
			  	421  IAQEFTAGRVKRPQIAIATWIVPSIVAFGTDNQKQRLLPPTFRGDIFWCQLFSEPGAGSD  480
			  	481  LASLATKATRVDGGWRITGQKIWTTGAQYSQWGALLARTDPSAPKHNGITYFLLDMKSEG  540
			  	541  VQVKPLRELTGKEFFNTVYLDDVFVPDELVLGEVNRGWEVSRNTLTAERVSIGGSDSTFL  600
			  	601  PTLGEFVDFVRDYRFEGQFDQVARHRAGQLIAEGHATKLLNLRSTLLTLAGGDPMAPAAI  660
			  	661  SKLLSMRTGQGYAEFAVSSFGTDAVIGDTERLPGKWGEYLLASRATTIYGGTSEVQLNII  720
			  	721  AERLLGLPRDP

Known structures in the PDB

No Known structures

Number of amino acids : 731

Domains assigned based on sequence.

Mtb Structural proteome models

CHOPIN models

Profile-based domain assignment

Structural/Functional domain family	Pfam acc.no./SCOP ID	Domain Region
Acyl-CoA_dh_N	PF02771	6-114
Acyl-CoA_dh_1	PF00441	204-348
Acyl-CoA_dh_N	PF02771	367-465
Acyl-CoA_dh_M	PF02770	469-520
Acyl-CoA_dh_1	PF00441	575-725

Mtb Structural Proteome models

Model Number	1
Model name	Rv0271c
Template	1JQI APDB CREDO
Template coverage	22_384
Template Identity(%)	23.2
Model coverage(%)	48.8
Normalized DOPE score	-0.383

Model Number	2
Model name	Rv0271c.2
Template	1JQI APDB CREDO
Template coverage	7_376
Template Identity(%)	22.3
Model coverage(%)	47.2
Normalized DOPE score	-0.134

Model Number	3
Model name	Rv0271c.1
Template	2C12 APDB CREDO
Template coverage	2_429
Template Identity(%)	18.8
Model coverage(%)	50.1
Normalized DOPE score	0.447

Structure Models from Chopin

Model Number	1
Profile	a.29.3.1 Click for model details
zscore	13.88
Residue begin	204
Residue end	348

Model Number	2
Profile	a.29.3.1 Click for model details
zscore	13.88
Residue begin	575
Residue end	719

Model Number	3
Profile	e.6.1.1 Click for model details
zscore	11.5
Residue begin	469
Residue end	520

Model Number	4
Profile	1.10.540.10, 2.40.110.10 Click for model details
zscore	10.53
Residue begin	1
Residue end	109

Binding pockets

STRING

Cytoscape Web will replace the contents of this div with protein-protein interaction network.

Protein interacting with Rv0271c	Gene name	Confidence Score
Rv3550	echA20	0.939
Rv0456c	echA2	0.934
Rv2679	echA15	0.934
Rv1935c	echA13	0.931
Rv0675	echA5	0.931
Rv2831	echA16	0.93
Rv1141c	echA11	0.93
Rv0673	echA4	0.93
Rv1071c	echA9	0.928
Rv1071c	echA9	0.928
Rv0971c	echA7	0.92
Rv0222	echA1	0.92
Rv0632c	echA3	0.92
Rv1142c	echA10	0.92
Rv3516	echA19	0.914
Rv3774	echA21	0.909
Rv2790c	ltp1	0.903
Rv2790c	ltp1	0.903

Potential ligand/drug binding sites

Protein Model	Pocket Number	Drug Binding Site	PMIN Score	Pvalue PMIN	PMAX Score	Pvalue PMAX
Rv0271c.1	3	2avv_MK1_E_902 PDB CREDO	0.620	0.156	0.606	0.002
Rv0271c.1	3	3cs9_NIL_D_600 PDB CREDO	0.768	0.038	0.599	0.002
Rv0271c.1	3	3cs9_NIL_C_600 PDB CREDO	0.767	0.039	0.598	0.002
Rv0271c.1	3	1tco_FK5_C_509 PDB CREDO	0.703	0.079	0.592	0.002
Rv0271c.1	3	2avv_MK1_A_901 PDB CREDO	0.591	0.190	0.577	0.003
Rv0271c.1	3	2o4k_DR7_A_301 PDB CREDO	0.590	0.191	0.576	0.003
Rv0271c.1	3	2nnk_ROC_A_401 PDB CREDO	0.597	0.183	0.569	0.004
Rv0271c.1	3	3k4v_ROC_D_201 PDB CREDO	0.565	0.223	0.565	0.004
Rv0271c.1	3	3ndt_ROC_D_100 PDB CREDO	0.593	0.188	0.565	0.004
Rv0271c.2	2	3frq_ERY_B_195 PDB CREDO	0.565	0.223	0.565	0.004
Rv0271c.1	3	2fxd_DR7_A_102 PDB CREDO	0.743	0.052	0.564	0.004
Rv0271c.1	3	3cs9_NIL_B_600 PDB CREDO	0.763	0.041	0.564	0.004
Rv0271c.2	2	1z2b_VLB_C_800 PDB CREDO	0.615	0.162	0.560	0.004
Rv0271c.2	2	1uwh_BAX_B_1723 PDB CREDO	0.595	0.185	0.559	0.004
Rv0271c.2	2	1uwh_BAX_A_1723 PDB CREDO	0.594	0.186	0.559	0.004
Rv0271c.1	3	3cs9_NIL_A_600 PDB CREDO	0.772	0.036	0.555	0.005
Rv0271c.2	2	2ab2_SNL_A_502 PDB CREDO	0.554	0.238	0.554	0.005
Rv0271c.1	3	1ya4_CTX_A_1 PDB CREDO	0.595	0.185	0.554	0.005
Rv0271c.2	2	1lhv_NOG_A_301 PDB CREDO	0.571	0.215	0.554	0.005
Rv0271c.1	3	1opj_STI_B_4 PDB CREDO	0.770	0.037	0.553	0.005
Rv0271c.1	3	1opj_STI_A_3 PDB CREDO	0.769	0.038	0.553	0.005
Rv0271c.2	2	2ab2_SNL_B_503 PDB CREDO	0.551	0.242	0.551	0.005
Rv0271c.2	2	3b0w_DGX_A_1 PDB CREDO	0.621	0.155	0.550	0.005
Rv0271c.2	2	2oax_SNL_B_2001 PDB CREDO	0.547	0.249	0.547	0.005
Rv0271c.1	3	3d1y_ROC_A_201 PDB CREDO	0.601	0.178	0.546	0.005
Rv0271c.2	2	2oax_SNL_C_3001 PDB CREDO	0.546	0.250	0.546	0.005
Rv0271c.1	3	3rgf_BAX_A_465 PDB CREDO	0.802	0.024	0.545	0.005
Rv0271c.2	2	3d91_REM_B_350 PDB CREDO	0.616	0.161	0.545	0.005
Rv0271c.2	2	2aa5_STR_A_301 PDB CREDO	0.600	0.179	0.545	0.005
Rv0271c.2	2	2hw2_RFP_A_1200 PDB CREDO	0.544	0.252	0.544	0.006
Rv0271c.1	3	3el4_ROC_A_100 PDB CREDO	0.556	0.236	0.543	0.006
Rv0271c.2	2	2aa5_STR_B_302 PDB CREDO	0.597	0.183	0.542	0.006
Rv0271c.1	3	3ndu_ROC_D_100 PDB CREDO	0.567	0.221	0.541	0.006
Rv0271c.2	2	1uwj_BAX_B_1723 PDB CREDO	0.611	0.166	0.541	0.006
Rv0271c.2	2	3d91_REM_A_350 PDB CREDO	0.611	0.166	0.541	0.006
Rv0271c.2	2	3mne_DEX_A_784 PDB CREDO	0.576	0.208	0.541	0.006
Rv0271c.2	2	3mnp_DEX_A_784 PDB CREDO	0.557	0.235	0.539	0.006
Rv0271c.1	3	1sdt_MK1_B_902 PDB CREDO	0.578	0.206	0.538	0.006
Rv0271c.2	2	3vhu_SNL_A_1001 PDB CREDO	0.538	0.261	0.538	0.006
Rv0271c.2	2	1p93_DEX_C_3999 PDB CREDO	0.572	0.214	0.537	0.006
Rv0271c.1	3	3k5v_STI_A_2 PDB CREDO	0.767	0.039	0.537	0.006
Rv0271c.1	3	3oxx_DR7_C_100 PDB CREDO	0.590	0.191	0.537	0.006
Rv0271c.2	2	3jwq_VIA_D_901 PDB CREDO	0.631	0.144	0.536	0.006
Rv0271c.1	3	1c6z_ROC_B_505 PDB CREDO	0.604	0.175	0.535	0.006
Rv0271c.2	2	2aax_PDN_A_502 PDB CREDO	0.589	0.192	0.535	0.006
Rv0271c.2	2	3gn8_DEX_B_247 PDB CREDO	0.570	0.217	0.534	0.006
Rv0271c.2	2	3mno_DEX_A_784 PDB CREDO	0.551	0.242	0.534	0.006
Rv0271c.2	2	2aa6_STR_A_401 PDB CREDO	0.588	0.194	0.534	0.006
Rv0271c.1	3	2aqu_DR7_B_300 PDB CREDO	0.617	0.159	0.533	0.007
Rv0271c.2	2	3gn8_DEX_A_247 PDB CREDO	0.568	0.219	0.533	0.007
Rv0271c.2	2	1uwj_BAX_A_1723 PDB CREDO	0.657	0.117	0.533	0.007
Rv0271c.2	2	1m2z_DEX_D_401 PDB CREDO	0.568	0.219	0.533	0.007
Rv0271c.1	3	3oxx_DR7_A_100 PDB CREDO	0.616	0.160	0.533	0.007
Rv0271c.2	2	2aax_PDN_B_503 PDB CREDO	0.586	0.196	0.532	0.007
Rv0271c.2	2	1p93_DEX_D_4999 PDB CREDO	0.566	0.222	0.531	0.007
Rv0271c.2	2	2aa6_STR_B_402 PDB CREDO	0.584	0.198	0.530	0.007
Rv0271c.1	3	2r5p_MK1_D_902 PDB CREDO	0.645	0.129	0.530	0.007
Rv0271c.1	3	3em4_DR7_V_100 PDB CREDO	0.645	0.129	0.530	0.007
Rv0271c.1	3	2r5p_MK1_B_902 PDB CREDO	0.645	0.130	0.530	0.007
Rv0271c.1	3	2nmy_ROC_A_401 PDB CREDO	0.567	0.220	0.530	0.007
Rv0271c.2	2	1m2z_DEX_A_301 PDB CREDO	0.564	0.224	0.529	0.007
Rv0271c.2	2	3ln1_CEL_A_682 PDB CREDO	0.564	0.225	0.529	0.007
Rv0271c.2	2	1fm6_BRL_X_504 PDB CREDO	0.545	0.251	0.528	0.007
Rv0271c.1	3	3eky_DR7_A_100 PDB CREDO	0.642	0.132	0.528	0.007
Rv0271c.1	3	2fxe_DR7_A_102 PDB CREDO	0.641	0.133	0.527	0.007
Rv0271c.2	2	3tne_RIT_A_401 PDB CREDO	0.527	0.277	0.527	0.007
Rv0271c.1	3	3s56_ROC_A_201 PDB CREDO	0.693	0.086	0.526	0.007
Rv0271c.2	2	1xzx_T3_X_500 PDB CREDO	0.543	0.253	0.526	0.007
Rv0271c.2	2	3ln1_CEL_B_682 PDB CREDO	0.561	0.229	0.526	0.007
Rv0271c.2	2	3ln1_CEL_C_682 PDB CREDO	0.561	0.229	0.526	0.007
Rv0271c.2	2	3uvv_T3_A_501 PDB CREDO	0.542	0.255	0.525	0.007
Rv0271c.2	2	2h42_VIA_A_901 PDB CREDO	0.617	0.159	0.524	0.008
Rv0271c.2	2	1bsx_T3_A_1 PDB CREDO	0.557	0.234	0.523	0.008
Rv0271c.2	2	1bsx_T3_B_2 PDB CREDO	0.557	0.234	0.523	0.008
Rv0271c.2	2	3gws_T3_X_500 PDB CREDO	0.557	0.234	0.522	0.008
Rv0271c.1	3	1sdv_MK1_B_902 PDB CREDO	0.669	0.106	0.522	0.008
Rv0271c.2	2	3aod_RFP_C_2002 PDB CREDO	0.708	0.075	0.521	0.008
Rv0271c.2	2	3h52_486_D_2 PDB CREDO	0.555	0.238	0.521	0.008
Rv0271c.1	3	3el9_DR7_A_100 PDB CREDO	0.686	0.092	0.521	0.008
Rv0271c.2	2	2h42_VIA_B_902 PDB CREDO	0.681	0.097	0.520	0.008
Rv0271c.2	2	1y0x_T44_X_500 PDB CREDO	0.552	0.241	0.519	0.008
Rv0271c.2	2	1a28_STR_B_2 PDB CREDO	0.535	0.265	0.518	0.008
Rv0271c.1	3	2qxs_RAL_B_600 PDB CREDO	0.699	0.081	0.517	0.008
Rv0271c.2	2	2h79_T3_A_1 PDB CREDO	0.568	0.219	0.516	0.009
Rv0271c.1	3	1t7i_017_A_200 PDB CREDO	0.528	0.276	0.515	0.009
Rv0271c.1	3	3pyy_STI_B_4 PDB CREDO	0.779	0.033	0.515	0.009
Rv0271c.2	2	3tkd_CYZ_A_266 PDB CREDO	0.514	0.296	0.514	0.009
Rv0271c.1	3	3mss_STI_C_1 PDB CREDO	0.778	0.034	0.514	0.009
Rv0271c.2	2	1uob_PNN_A_1311 PDB CREDO	0.563	0.225	0.514	0.009
Rv0271c.2	2	2oax_SNL_F_6001 PDB CREDO	0.563	0.226	0.513	0.009
Rv0271c.1	3	3k5v_STI_B_2 PDB CREDO	0.776	0.034	0.513	0.009
Rv0271c.1	3	3mss_STI_A_1 PDB CREDO	0.776	0.034	0.513	0.009
Rv0271c.2	2	1ya3_STR_B_2001 PDB CREDO	0.626	0.150	0.513	0.009
Rv0271c.2	2	3ln1_CEL_D_682 PDB CREDO	0.604	0.174	0.513	0.009
Rv0271c.1	3	1k6c_MK1_B_902 PDB CREDO	0.524	0.281	0.512	0.009
Rv0271c.1	3	3ms9_STI_A_1 PDB CREDO	0.775	0.035	0.512	0.009
Rv0271c.2	2	3frq_ERY_A_195 PDB CREDO	0.596	0.184	0.512	0.009
Rv0271c.2	2	3jwq_VIA_B_901 PDB CREDO	0.669	0.106	0.511	0.009
Rv0271c.1	3	2hyy_STI_C_600 PDB CREDO	0.774	0.036	0.511	0.009
Rv0271c.1	3	2qxs_RAL_A_600 PDB CREDO	0.692	0.087	0.511	0.009
Rv0271c.1	3	3gvu_STI_A_1001 PDB CREDO	0.774	0.036	0.511	0.009
Rv0271c.1	3	3pyy_STI_A_3 PDB CREDO	0.774	0.036	0.511	0.009
Rv0271c.1	3	3mss_STI_D_1 PDB CREDO	0.773	0.036	0.511	0.009
Rv0271c.2	2	2oax_SNL_D_4001 PDB CREDO	0.561	0.229	0.511	0.009
Rv0271c.2	2	1p93_DEX_A_1999 PDB CREDO	0.602	0.177	0.511	0.009
Rv0271c.2	2	2oax_SNL_E_5001 PDB CREDO	0.560	0.230	0.511	0.009
Rv0271c.1	3	3ms9_STI_B_1 PDB CREDO	0.773	0.036	0.511	0.009
Rv0271c.1	3	3oez_STI_A_601 PDB CREDO	0.773	0.036	0.511	0.009
Rv0271c.1	3	2hyy_STI_A_600 PDB CREDO	0.772	0.036	0.510	0.009
Rv0271c.1	3	2hyy_STI_D_600 PDB CREDO	0.772	0.036	0.510	0.009
Rv0271c.2	2	2oax_SNL_A_1001 PDB CREDO	0.559	0.231	0.510	0.009
Rv0271c.1	3	3mss_STI_B_1 PDB CREDO	0.771	0.037	0.509	0.009
Rv0271c.2	2	1p93_DEX_B_2999 PDB CREDO	0.600	0.179	0.509	0.009
Rv0271c.1	3	1iep_STI_A_201 PDB CREDO	0.770	0.037	0.509	0.010
Rv0271c.1	3	1hxw_RIT_B_301 PDB CREDO	0.619	0.157	0.509	0.010
Rv0271c.1	3	3gp0_NIL_A_1 PDB CREDO	0.635	0.140	0.508	0.010
Rv0271c.1	3	2ieo_017_A_402 PDB CREDO	0.508	0.306	0.508	0.010
Rv0271c.1	3	1iep_STI_B_202 PDB CREDO	0.769	0.038	0.508	0.010
Rv0271c.2	2	4eb6_VLB_C_503 PDB CREDO	0.663	0.112	0.506	0.010
Rv0271c.1	3	3pwr_ROC_A_401 PDB CREDO	0.543	0.253	0.506	0.010
Rv0271c.1	3	3oxc_ROC_A_401 PDB CREDO	0.592	0.189	0.506	0.010
Rv0271c.1	3	1hsh_MK1_A_401 PDB CREDO	0.666	0.109	0.506	0.010
Rv0271c.1	3	3ogq_AB1_A_200 PDB CREDO	0.599	0.180	0.505	0.010
Rv0271c.2	2	3ut5_LOC_D_502 PDB CREDO	0.504	0.311	0.504	0.010
Rv0271c.2	2	3vn2_TLS_A_501 PDB CREDO	0.520	0.287	0.504	0.010
Rv0271c.2	2	3h52_486_B_1 PDB CREDO	0.553	0.240	0.504	0.010
Rv0271c.1	3	3jw2_017_A_401 PDB CREDO	0.528	0.276	0.503	0.010
Rv0271c.2	2	1nhz_486_A_800 PDB CREDO	0.573	0.213	0.503	0.010
Rv0271c.2	2	2h77_T3_A_1 PDB CREDO	0.573	0.213	0.503	0.010
Rv0271c.1	3	2nnp_ROC_A_401 PDB CREDO	0.513	0.298	0.501	0.011
Rv0271c.1	3	3em4_DR7_A_100 PDB CREDO	0.660	0.115	0.501	0.011
Rv0271c.1	3	2xkw_P1B_A_1478 PDB CREDO	0.594	0.186	0.501	0.011
Rv0271c.1	3	1rl8_RIT_A_9001 PDB CREDO	0.551	0.243	0.500	0.011

Similarity to known drug target from sensitive sequence analysis

No drug targets

List of small molecules tested from TIBLE

Data not available

Off-target activity - ligand based from TIBLE

Data not available

Small molecules involved in protein-protein complex from TIMBAL .Proteins similar to Mtb based on sequence analysis.

Data not available

STITCH interactions

Chemical Name	Confidence score	Molecular Weight
naphthyl-2-methyl-succinyl-CoAPubChem	0.9	1007.79
c1137PubChem	0.9	875.672
C16468PubChem	0.9	875.672
5-methylhex-4-enoyl-CoAPubChem	0.9	877.688