SInCRe - Rv0147

Tuberculist information

Gene name	Rv0147
Protein function	Probable aldehyde dehydrogenase (NAD+) dependent
Functional category(tuberculist)	intermediary metabolism and respiration
Gene location(kb)	173.238
Molecular mass(da)	55035.1
External sites	TB Database TubercuList WebTB

Protein sequence

Number of amino acids : 506

	  		  	1    MSDRVKAVAPPDGRTMMTTESVARKTQKSETEAPREPAPVSDEKQTDVAKTVARLRKTFA   60
			  	61   SGRTRSVEWRKQQLRALQKLMDENEDAIAAALAEDLDRNPFEAYLADIATTSAEAKYAAK  120
			  	121  RVRRWMRRRYLLLEVPQLPGRGWVEYEPYGTVLIIGAWNYPFYLTLGPAVGAIAAGNAVV  180
			  	181  LKPSEIAAASAHLMTELVYRYLDTEAIAVVQGDGAVSQELIAQGFDRVMFTGGTEIGRKV  240
			  	241  YEGAAPHLTPVTLELGGKSPVIVAADADVDVAAKRIAWIKLLNAGQTCVAPDYVLADATV  300
			  	301  RDELVSKITAALTKFRSGAPQGMRIVNQRQFDRLSGYLAAAKTDAAADGGGVVVGGDCDA  360
			  	361  SNLRIQPTVVVDPDPDGPLMSNEIFGPILPVVTVKSLDDAIRFVNSRPKPLSAYLFTKSR  420
			  	421  AVRERVIREVPAGGMMVNHLAFQVSTAKLPFGGVGASGMGAYHGRWGFEEFSHRKSVLTK  480
			  	481  PTRPDLSSFIYPPYTERAIKVARRLF

Known structures in the PDB

No Known structures

Number of amino acids : 506

Domains assigned based on sequence.

Mtb Structural proteome models

CHOPIN models

Profile-based domain assignment

Structural/Functional domain family	Pfam acc.no./SCOP ID	Domain Region
Aldedh	PF00171	19-477

Mtb Structural Proteome models

Model Number	1
Model name	Rv0147
Template	1AD3 APDB CREDO
Template coverage	3_444
Template Identity(%)	45.0
Model coverage(%)	87.9
Normalized DOPE score	-0.599

Model Number	2
Model name	Rv0147.1
Template	1UXT APDB CREDO
Template coverage	6_500
Template Identity(%)	25.8
Model coverage(%)	96.4
Normalized DOPE score	-0.181

Structure Models from Chopin

Model Number	1
Profile	c.82.1.1 Click for model details
zscore	49.39
Residue begin	1
Residue end	506

Model Number	2
Profile	3.40.309.10 Click for model details
zscore	24.06
Residue begin	254
Residue end	460

Binding pockets

STRING

Cytoscape Web will replace the contents of this div with protein-protein interaction network.

Protein interacting with Rv0147	Gene name	Confidence Score
Rv0409	ackA	0.971
Rv3667	acs	0.948
Rv3667	acs	0.948
Rv3170	aofH	0.937
Rv0853c	pdc	0.93
Rv0853c	pdc	0.93
Rv0853c	pdc	0.93
Rv3432c	gadB	0.924
Rv0751c	mmsB	0.916
Rv0751c	mmsB	0.916
Rv3535c	hsaG	0.913
Rv3535c	hsaG	0.913
Rv0860	fadB	0.911
Rv0860	fadB	0.911
Rv3252c	alkB	0.911
Rv0860	fadB	0.911
Rv0753c	mmsA	0.908
Rv2589	gabT	0.907
Rv3601c	panD	0.905
Rv0761c	adhB	0.903
Rv0761c	adhB	0.903
Rv0761c	adhB	0.903
Rv0162c	adhE1	0.902
Rv0162c	adhE1	0.902
Rv1862	adhA	0.902
Rv1862	adhA	0.902
Rv2205c	Rv2205c	0.902

Potential ligand/drug binding sites

Protein Model	Pocket Number	Drug Binding Site	PMIN Score	Pvalue PMIN	PMAX Score	Pvalue PMAX
Rv0147.1	21	1uwj_BAX_A_1723 PDB CREDO	0.630	0.145	0.612	0.002
Rv0147.1	14	2fum_MIX_D_3539 PDB CREDO	0.628	0.147	0.607	0.002
Rv0147.1	14	3k54_1N1_A_1 PDB CREDO	0.673	0.103	0.605	0.002
Rv0147.1	14	3oht_1N1_B_1000 PDB CREDO	0.622	0.153	0.601	0.002
Rv0147.1	14	3oct_1N1_A_663 PDB CREDO	0.597	0.182	0.597	0.002
Rv0147.1	14	1jg2_ADN_A_500 PDB CREDO	0.595	0.185	0.595	0.002
Rv0147.1	14	3bbt_FMM_D_91 PDB CREDO	0.614	0.163	0.593	0.002
Rv0147.1	19	1lhu_EST_A_301 PDB CREDO	0.585	0.198	0.585	0.003
Rv0147.1	21	1uwj_BAX_B_1723 PDB CREDO	0.616	0.160	0.581	0.003
Rv0147.1	14	3spk_TPV_A_100 PDB CREDO	0.621	0.155	0.580	0.003
Rv0147.1	14	3oht_1N1_A_1000 PDB CREDO	0.667	0.108	0.578	0.003
Rv0147.1	21	3d91_REM_A_350 PDB CREDO	0.609	0.168	0.575	0.003
Rv0147.1	14	2ito_IRE_A_2020 PDB CREDO	0.689	0.090	0.574	0.003
Rv0147.1	14	2fum_MIX_A_539 PDB CREDO	0.615	0.162	0.573	0.003
Rv0147.1	21	3d91_REM_B_350 PDB CREDO	0.607	0.171	0.573	0.003
Rv0147.1	14	2ity_IRE_A_2020 PDB CREDO	0.736	0.056	0.567	0.004
Rv0147.1	21	2nni_MTK_A_501 PDB CREDO	0.584	0.199	0.567	0.004
Rv0147.1	14	1jg3_ADN_A_500 PDB CREDO	0.631	0.144	0.567	0.004
Rv0147.1	16	1pg2_ADN_A_552 PDB CREDO	0.648	0.127	0.565	0.004
Rv0147.1	14	2y6o_1N1_A_1892 PDB CREDO	0.665	0.110	0.563	0.004
Rv0147.1	14	1s9p_DES_A_459 PDB CREDO	0.582	0.201	0.562	0.004
Rv0147.1	14	2gqg_1N1_A_501 PDB CREDO	0.602	0.177	0.561	0.004
Rv0147.1	21	1uwh_BAX_A_1723 PDB CREDO	0.630	0.145	0.560	0.004
Rv0147.1	14	1lhu_EST_A_301 PDB CREDO	0.579	0.205	0.559	0.004
Rv0147.1	21	1uwh_BAX_B_1723 PDB CREDO	0.628	0.147	0.558	0.004
Rv0147.1	16	2y7j_B49_D_1294 PDB CREDO	0.582	0.201	0.557	0.004
Rv0147.1	21	1z2b_VLB_C_800 PDB CREDO	0.608	0.170	0.557	0.004
Rv0147.1	19	2zbv_ADN_A_501 PDB CREDO	0.598	0.181	0.556	0.005
Rv0147.1	16	2x1l_ADN_C_601 PDB CREDO	0.581	0.203	0.556	0.005
Rv0147.1	14	3qlg_1N1_A_601 PDB CREDO	0.692	0.087	0.555	0.005
Rv0147.1	21	1hwk_117_B_1 PDB CREDO	0.554	0.238	0.554	0.005
Rv0147.1	14	3kw2_ADN_A_300 PDB CREDO	0.639	0.135	0.554	0.005
Rv0147.1	21	3tne_RIT_A_401 PDB CREDO	0.662	0.113	0.552	0.005
Rv0147.1	14	3g5d_1N1_A_1 PDB CREDO	0.686	0.092	0.550	0.005
Rv0147.1	14	3qlg_1N1_B_601 PDB CREDO	0.685	0.093	0.549	0.005
Rv0147.1	14	2xkw_P1B_B_1475 PDB CREDO	0.589	0.192	0.549	0.005
Rv0147.1	14	3g5d_1N1_B_1 PDB CREDO	0.684	0.093	0.549	0.005
Rv0147.1	14	3bbt_FMM_B_91 PDB CREDO	0.657	0.117	0.548	0.005
Rv0147.1	19	2y00_Y00_A_601 PDB CREDO	0.548	0.247	0.548	0.005
Rv0147.1	19	2y00_Y00_B_601 PDB CREDO	0.544	0.253	0.544	0.006
Rv0147.1	19	2y01_Y00_B_601 PDB CREDO	0.543	0.254	0.543	0.006
Rv0147.1	14	3jwq_VIA_D_901 PDB CREDO	0.562	0.227	0.543	0.006
Rv0147.1	14	3kw2_ADN_B_300 PDB CREDO	0.704	0.078	0.543	0.006
Rv0147.1	21	3q70_RIT_A_2001 PDB CREDO	0.592	0.188	0.542	0.006
Rv0147.1	2	4eyb_0WO_B_301 PDB CREDO	0.563	0.227	0.542	0.006
Rv0147.1	21	3tne_RIT_B_401 PDB CREDO	0.649	0.125	0.542	0.006
Rv0147.1	14	1mx1_THA_C_3 PDB CREDO	0.560	0.231	0.540	0.006
Rv0147.1	19	1fdt_EST_A_350 PDB CREDO	0.625	0.151	0.539	0.006
Rv0147.1	15	3k2h_LYA_B_514 PDB CREDO	0.538	0.261	0.538	0.006
Rv0147.1	19	2zbv_ADN_B_502 PDB CREDO	0.600	0.179	0.538	0.006
Rv0147.1	14	2itz_IRE_A_2021 PDB CREDO	0.725	0.063	0.537	0.006
Rv0147.1	14	1lhv_NOG_A_301 PDB CREDO	0.632	0.143	0.535	0.006
Rv0147.1	16	2y7j_B49_B_1294 PDB CREDO	0.632	0.143	0.534	0.006
Rv0147.1	19	1q23_FUA_I_707 PDB CREDO	0.533	0.268	0.533	0.007
Rv0147.1	21	1hwk_117_A_2 PDB CREDO	0.565	0.223	0.533	0.007
Rv0147.1	14	1uwh_BAX_A_1723 PDB CREDO	0.691	0.088	0.532	0.007
Rv0147.1	16	2y7j_B49_A_1294 PDB CREDO	0.582	0.201	0.532	0.007
Rv0147.1	21	3tkd_CYZ_B_267 PDB CREDO	0.598	0.181	0.531	0.007
Rv0147.1	14	1uwh_BAX_B_1723 PDB CREDO	0.689	0.089	0.531	0.007
Rv0147.1	19	3nrr_D16_B_520 PDB CREDO	0.549	0.245	0.531	0.007
Rv0147.1	21	1hwk_117_C_4 PDB CREDO	0.562	0.227	0.530	0.007
Rv0147.1	15	4eyb_0WO_A_303 PDB CREDO	0.530	0.273	0.530	0.007
Rv0147.1	19	1q23_FUA_A_702 PDB CREDO	0.530	0.273	0.530	0.007
Rv0147.1	14	1kij_NOV_A_400 PDB CREDO	0.547	0.248	0.528	0.007
Rv0147.1	21	2v0z_C41_O_1327 PDB CREDO	0.640	0.135	0.528	0.007
Rv0147.1	21	3frq_ERY_A_195 PDB CREDO	0.543	0.254	0.528	0.007
Rv0147.1	14	3sxr_1N1_A_1 PDB CREDO	0.684	0.094	0.528	0.007
Rv0147.1	21	1lhv_NOG_A_301 PDB CREDO	0.652	0.123	0.527	0.007
Rv0147.1	14	3tne_RIT_A_401 PDB CREDO	0.642	0.132	0.527	0.007
Rv0147.1	14	1ya3_STR_A_1001 PDB CREDO	0.526	0.278	0.526	0.007
Rv0147.1	14	3rif_IVM_A_402 PDB CREDO	0.565	0.224	0.526	0.007
Rv0147.1	14	3ria_IVM_C_349 PDB CREDO	0.564	0.224	0.526	0.007
Rv0147.1	14	3ri5_IVM_C_350 PDB CREDO	0.564	0.225	0.525	0.007
Rv0147.1	19	2y01_Y00_A_601 PDB CREDO	0.544	0.252	0.525	0.007
Rv0147.1	3	3g0e_B49_A_9000 PDB CREDO	0.547	0.249	0.525	0.007
Rv0147.1	14	1ie4_T44_B_328 PDB CREDO	0.654	0.121	0.525	0.008
Rv0147.1	14	1ya3_STR_B_2001 PDB CREDO	0.525	0.281	0.525	0.008
Rv0147.1	14	3rif_IVM_D_402 PDB CREDO	0.563	0.226	0.525	0.008
Rv0147.1	19	2x0y_X0T_A_1625 PDB CREDO	0.585	0.198	0.524	0.008
Rv0147.1	14	3rif_IVM_B_403 PDB CREDO	0.562	0.227	0.524	0.008
Rv0147.1	14	4eyb_0WO_A_303 PDB CREDO	0.543	0.254	0.524	0.008
Rv0147.1	14	3ln1_CEL_D_682 PDB CREDO	0.542	0.255	0.524	0.008
Rv0147.1	3	1i2w_CFX_B_2300 PDB CREDO	0.545	0.251	0.523	0.008
Rv0147.1	2	4eyb_0WO_A_303 PDB CREDO	0.584	0.199	0.523	0.008
Rv0147.1	19	2zbv_ADN_C_503 PDB CREDO	0.606	0.172	0.523	0.008
Rv0147.1	2	4eb6_VLB_C_503 PDB CREDO	0.563	0.227	0.523	0.008
Rv0147.1	21	3b0w_DGX_A_1 PDB CREDO	0.554	0.238	0.523	0.008
Rv0147.1	21	1hwl_FBI_B_1 PDB CREDO	0.570	0.216	0.522	0.008
Rv0147.1	3	3sv8_SV6_A_1 PDB CREDO	0.522	0.284	0.522	0.008
Rv0147.1	21	1hwl_FBI_D_3 PDB CREDO	0.569	0.218	0.521	0.008
Rv0147.1	19	3upr_1KX_A_277 PDB CREDO	0.626	0.149	0.520	0.008
Rv0147.1	2	3kw2_ADN_A_300 PDB CREDO	0.520	0.288	0.520	0.008
Rv0147.1	14	3rif_IVM_A_403 PDB CREDO	0.558	0.233	0.520	0.008
Rv0147.1	3	3mdz_EZL_A_264 PDB CREDO	0.564	0.224	0.519	0.008
Rv0147.1	21	3tkd_CYZ_A_266 PDB CREDO	0.621	0.155	0.518	0.008
Rv0147.1	14	3h52_486_C_4 PDB CREDO	0.556	0.236	0.518	0.008
Rv0147.1	3	1i2w_CFX_A_1300 PDB CREDO	0.539	0.259	0.518	0.008
Rv0147.1	19	3upr_1KX_C_277 PDB CREDO	0.623	0.153	0.518	0.008
Rv0147.1	14	1jg3_ADN_B_550 PDB CREDO	0.645	0.130	0.517	0.008
Rv0147.1	3	3k2h_LYA_A_514 PDB CREDO	0.582	0.201	0.517	0.008
Rv0147.1	19	3vri_1KX_A_301 PDB CREDO	0.646	0.128	0.516	0.009
Rv0147.1	21	1hwl_FBI_A_2 PDB CREDO	0.564	0.225	0.516	0.009
Rv0147.1	14	3jwq_VIA_B_901 PDB CREDO	0.553	0.239	0.515	0.009
Rv0147.1	21	1t46_STI_A_3 PDB CREDO	0.608	0.170	0.515	0.009
Rv0147.1	19	1a28_STR_A_1 PDB CREDO	0.515	0.295	0.515	0.009
Rv0147.1	21	1hwk_117_D_3 PDB CREDO	0.579	0.204	0.515	0.009
Rv0147.1	21	1hwl_FBI_C_4 PDB CREDO	0.562	0.227	0.515	0.009
Rv0147.1	3	1fj8_CER_C_500 PDB CREDO	0.536	0.263	0.514	0.009
Rv0147.1	14	1s9p_DES_D_600 PDB CREDO	0.533	0.269	0.514	0.009
Rv0147.1	14	2q1v_PDN_A_248 PDB CREDO	0.514	0.296	0.514	0.009
Rv0147.1	15	4eyb_0WO_B_301 PDB CREDO	0.552	0.241	0.514	0.009
Rv0147.1	14	3h0a_9RA_A_500 PDB CREDO	0.532	0.270	0.514	0.009
Rv0147.1	14	2prg_BRL_A_1 PDB CREDO	0.531	0.271	0.513	0.009
Rv0147.1	21	3bjw_SVR_E_503 PDB CREDO	0.589	0.192	0.513	0.009
Rv0147.1	14	3tne_RIT_B_401 PDB CREDO	0.625	0.150	0.512	0.009
Rv0147.1	3	1fj8_CER_A_500 PDB CREDO	0.534	0.267	0.512	0.009
Rv0147.1	3	3sxr_1N1_B_2 PDB CREDO	0.533	0.268	0.512	0.009
Rv0147.1	14	1fm6_BRL_D_503 PDB CREDO	0.530	0.273	0.512	0.009
Rv0147.1	14	1mx1_THA_E_5 PDB CREDO	0.570	0.217	0.512	0.009
Rv0147.1	14	3sxr_1N1_B_2 PDB CREDO	0.691	0.088	0.512	0.009
Rv0147.1	3	2bxg_IBP_B_2001 PDB CREDO	0.556	0.236	0.511	0.009
Rv0147.1	3	2riw_T44_A_1395 PDB CREDO	0.533	0.269	0.511	0.009
Rv0147.1	19	3apv_TP0_A_190 PDB CREDO	0.549	0.246	0.511	0.009
Rv0147.1	14	2h42_VIA_A_901 PDB CREDO	0.528	0.275	0.510	0.009
Rv0147.1	3	1fj8_CER_B_500 PDB CREDO	0.532	0.270	0.510	0.009
Rv0147.1	3	2xn5_FUN_A_1356 PDB CREDO	0.531	0.271	0.510	0.009
Rv0147.1	15	4eb6_VLB_C_503 PDB CREDO	0.529	0.275	0.510	0.009
Rv0147.1	14	3erd_DES_B_800 PDB CREDO	0.547	0.248	0.510	0.009
Rv0147.1	15	2kce_D16_A_566 PDB CREDO	0.590	0.191	0.509	0.009
Rv0147.1	14	3erd_DES_A_600 PDB CREDO	0.547	0.249	0.509	0.009
Rv0147.1	14	3rhw_IVM_A_348 PDB CREDO	0.611	0.166	0.509	0.009
Rv0147.1	14	3ria_IVM_E_348 PDB CREDO	0.611	0.166	0.509	0.009
Rv0147.1	14	4eb6_VLB_C_503 PDB CREDO	0.547	0.249	0.509	0.009
Rv0147.1	14	3ria_IVM_E_349 PDB CREDO	0.610	0.167	0.509	0.010
Rv0147.1	19	2x9g_LYA_D_1270 PDB CREDO	0.527	0.277	0.509	0.010
Rv0147.1	19	3apx_Z80_A_190 PDB CREDO	0.547	0.248	0.509	0.010
Rv0147.1	3	1uho_VDN_A_1000 PDB CREDO	0.530	0.272	0.509	0.010
Rv0147.1	3	4agd_B49_A_2000 PDB CREDO	0.530	0.272	0.509	0.010
Rv0147.1	21	1uob_PNN_A_1311 PDB CREDO	0.555	0.236	0.508	0.010
Rv0147.1	14	1ie4_T44_A_128 PDB CREDO	0.714	0.070	0.508	0.010
Rv0147.1	14	2zva_1N1_A_513 PDB CREDO	0.659	0.116	0.508	0.010
Rv0147.1	14	3rhw_IVM_B_348 PDB CREDO	0.610	0.168	0.508	0.010
Rv0147.1	14	3rhw_IVM_D_349 PDB CREDO	0.610	0.168	0.508	0.010
Rv0147.1	14	3ri5_IVM_A_349 PDB CREDO	0.610	0.168	0.508	0.010
Rv0147.1	3	1fj8_CER_D_500 PDB CREDO	0.529	0.274	0.508	0.010
Rv0147.1	14	3ria_IVM_A_348 PDB CREDO	0.609	0.169	0.508	0.010
Rv0147.1	15	1cil_ETS_A_263 PDB CREDO	0.544	0.253	0.507	0.010
Rv0147.1	14	1m17_AQ4_A_999 PDB CREDO	0.713	0.071	0.507	0.010
Rv0147.1	16	1g50_EST_C_2600 PDB CREDO	0.529	0.273	0.507	0.010
Rv0147.1	3	1pbc_BHA_A_396 PDB CREDO	0.602	0.177	0.507	0.010
Rv0147.1	14	3k2h_LYA_B_514 PDB CREDO	0.524	0.281	0.506	0.010
Rv0147.1	14	3ri5_IVM_B_349 PDB CREDO	0.607	0.170	0.506	0.010
Rv0147.1	16	4dta_ADN_A_401 PDB CREDO	0.529	0.274	0.506	0.010
Rv0147.1	3	2xn6_T44_A_1370 PDB CREDO	0.527	0.277	0.506	0.010
Rv0147.1	16	2j7x_EST_A_1454 PDB CREDO	0.529	0.275	0.506	0.010
Rv0147.1	2	2cbr_A80_A_201 PDB CREDO	0.506	0.309	0.506	0.010
Rv0147.1	19	1lhv_NOG_A_301 PDB CREDO	0.619	0.157	0.506	0.010
Rv0147.1	14	3rhw_IVM_B_349 PDB CREDO	0.607	0.171	0.506	0.010
Rv0147.1	14	3rhw_IVM_D_348 PDB CREDO	0.607	0.171	0.506	0.010
Rv0147.1	14	3ri5_IVM_D_349 PDB CREDO	0.607	0.171	0.506	0.010
Rv0147.1	14	3rif_IVM_E_402 PDB CREDO	0.607	0.171	0.506	0.010
Rv0147.1	14	1uwj_BAX_B_1723 PDB CREDO	0.697	0.083	0.506	0.010
Rv0147.1	14	3adx_IMN_B_3 PDB CREDO	0.682	0.096	0.505	0.010
Rv0147.1	14	3ria_IVM_C_350 PDB CREDO	0.606	0.172	0.505	0.010
Rv0147.1	19	1q23_FUA_K_712 PDB CREDO	0.523	0.283	0.505	0.010
Rv0147.1	16	1pcg_EST_A_1 PDB CREDO	0.528	0.276	0.505	0.010
Rv0147.1	16	2vuf_FUA_A_2001 PDB CREDO	0.528	0.276	0.505	0.010
Rv0147.1	21	3b0w_DGX_B_1 PDB CREDO	0.535	0.266	0.505	0.010
Rv0147.1	14	2h77_T3_A_1 PDB CREDO	0.541	0.257	0.505	0.010
Rv0147.1	15	1kij_NOV_A_400 PDB CREDO	0.541	0.256	0.505	0.010
Rv0147.1	14	2uxo_TAC_B_1211 PDB CREDO	0.681	0.096	0.505	0.010
Rv0147.1	19	2x9g_LYA_C_1270 PDB CREDO	0.523	0.284	0.505	0.010
Rv0147.1	15	2cbr_A80_A_201 PDB CREDO	0.563	0.227	0.504	0.010
Rv0147.1	16	1qkt_EST_A_600 PDB CREDO	0.527	0.278	0.504	0.010
Rv0147.1	14	1nhz_486_A_800 PDB CREDO	0.540	0.259	0.504	0.010
Rv0147.1	14	1kij_NOV_B_444 PDB CREDO	0.604	0.174	0.504	0.010
Rv0147.1	19	1q23_FUA_D_705 PDB CREDO	0.522	0.285	0.504	0.010
Rv0147.1	19	3u9f_CLM_J_221 PDB CREDO	0.606	0.171	0.504	0.010
Rv0147.1	16	4dt8_ADN_A_401 PDB CREDO	0.526	0.278	0.503	0.010
Rv0147.1	14	2gqg_1N1_B_502 PDB CREDO	0.557	0.234	0.503	0.010
Rv0147.1	15	3k2h_LYA_A_514 PDB CREDO	0.606	0.172	0.503	0.010
Rv0147.1	3	2xn7_T44_A_1355 PDB CREDO	0.524	0.282	0.503	0.010
Rv0147.1	15	2zi9_CL9_A_401 PDB CREDO	0.540	0.258	0.503	0.011
Rv0147.1	14	3oez_STI_B_601 PDB CREDO	0.612	0.165	0.502	0.011
Rv0147.1	3	2ceo_T44_A_1395 PDB CREDO	0.570	0.217	0.502	0.011
Rv0147.1	14	1zgy_BRL_A_503 PDB CREDO	0.537	0.262	0.502	0.011
Rv0147.1	16	2ki5_AC2_A_1 PDB CREDO	0.501	0.316	0.501	0.011
Rv0147.1	16	2ki5_AC2_B_2 PDB CREDO	0.501	0.316	0.501	0.011
Rv0147.1	19	3apw_DP0_B_190 PDB CREDO	0.539	0.260	0.501	0.011
Rv0147.1	14	2h79_T3_A_1 PDB CREDO	0.555	0.237	0.501	0.011
Rv0147.1	14	3ut5_LOC_D_502 PDB CREDO	0.611	0.166	0.501	0.011
Rv0147.1	14	3nrr_D16_B_520 PDB CREDO	0.501	0.317	0.501	0.011
Rv0147.1	16	1s1u_NVP_A_999 PDB CREDO	0.546	0.250	0.501	0.011
Rv0147.1	14	1p93_DEX_B_2999 PDB CREDO	0.518	0.290	0.501	0.011
Rv0147.1	3	2ceo_T44_B_1395 PDB CREDO	0.569	0.218	0.501	0.011
Rv0147.1	19	2w26_RIV_A_1001 PDB CREDO	0.603	0.176	0.501	0.011

Similarity to known drug target from sensitive sequence analysis

No drug targets

List of small molecules tested from TIBLE

Data not available

Off-target activity - ligand based from TIBLE

Data not available

Small molecules involved in protein-protein complex from TIMBAL .Proteins similar to Mtb based on sequence analysis.

Data not available

STITCH interactions

Chemical Name	Confidence score	Molecular Weight
acetaldehydePubChem	0.971	44.0526
acetatePubChem	0.938	59.044
auxinPubChem	0.912	174.176
gamma-aminobutyric acidPubChem	0.901	103.12
indole-3-acetaldehydePubChem	0.901	159.185
3-chloro-2-PropenalPubChem	0.9	90.5083
N-acetyl-gamma-aminobutyraldehydePubChem	0.9	129.157
methylmalonate semialdehydePubChem	0.9	102.089
C16348PubChem	0.9	90.5083
perillic acidPubChem	0.9	166.217
5-hydroxyindole-3-acetaldehydePubChem	0.9	175.184
beta-alaninePubChem	0.9	89.0932
glyceratePubChem	0.9	106.077
C06002PubChem	0.9	102.089