SInCRe - Rv1293

Tuberculist information

Gene name	lysA
Protein function	Diaminopimelate decarboxylase LysA (DAP decarboxylase)
Functional category(tuberculist)	intermediary metabolism and respiration
Gene location(kb)	1448.03
Molecular mass(da)	47425.9
External sites	TB Database TubercuList WebTB

Protein sequence

Number of amino acids : 447

	  		  	1    VNELLHLAPNVWPRNTTRDEVGVVCIAGIPLTQLAQEYGTPLFVIDEDDFRSRCRETAAA   60
			  	61   FGSGANVHYAAKAFLCSEVARWISEEGLCLDVCTGGELAVALHASFPPERITLHGNNKSV  120
			  	121  SELTAAVKAGVGHIVVDSMTEIERLDAIAGEAGIVQDVLVRLTVGVEAHTHEFISTAHED  180
			  	181  QKFGLSVASGAAMAAVRRVFATDHLRLVGLHSHIGSQIFDVDGFELAAHRVIGLLRDVVG  240
			  	241  EFGPEKTAQIATVDLGGGLGISYLPSDDPPPIAELAAKLGTIVSDESTAVGLPTPKLVVE  300
			  	301  PGRAIAGPGTITLYEVGTVKDVDVSATAHRRYVSVDGGMSDNIRTALYGAQYDVRLVSRV  360
			  	361  SDAPPVPARLVGKHCESGDIIVRDTWVPDDIRPGDLVAVAATGAYCYSLSSRYNMVGRPA  420
			  	421  VVAVHAGNARLVLRRETVDDLLSLEVR

Known structures in the PDB

	PDB ID	1HKV
	Total residue count	906
	Number of chains	2
	Method	X-RAY
	Resolution	2.6

	PDB ID	1HKW
	Total residue count	906
	Number of chains	2
	Method	X-RAY
	Resolution	2.8

	PDB ID	2O0T
	Total residue count	1868
	Number of chains	4
	Method	X-RAY
	Resolution	2.33

Number of amino acids : 447

Domains assigned based on sequence.

Mtb Structural proteome models

CHOPIN models

Profile-based domain assignment

Structural/Functional domain family	Pfam acc.no./SCOP ID	Domain Region
Orn_Arg_deC_N	PF02784	46-308
Orn_DAP_Arg_deC	PF00278	284-424

Mtb Structural Proteome models

Model Number	1
Model name	Rv1293_2o0t_A
Template	2O0T APDB CREDO
Template coverage	2_447
Template Identity(%)	100.0
Model coverage(%)	99.6
Normalized DOPE score	-1.387

Model Number	2
Model name	Rv1293
Template	1HKV APDB CREDO
Template coverage	2_447
Template Identity(%)	100.0
Model coverage(%)	99.6
Normalized DOPE score	-1.118

Structure Models from Chopin

Model Number	1
Profile	c.1.6.1 Click for model details
zscore	32.98
Residue begin	46
Residue end	308

Model Number	2
Profile	2.40.37.10 Click for model details
zscore	13.51
Residue begin	249
Residue end	447

Binding pockets

STRING

Cytoscape Web will replace the contents of this div with protein-protein interaction network.

Protein interacting with Rv1293	Gene name	Confidence Score
Rv2726c	dapF	0.999
Rv2773c	dapB	0.997
Rv2773c	dapB	0.997
Rv1295	thrC	0.996
Rv1294	thrA	0.995
Rv1294	thrA	0.995
Rv1294	thrA	0.995
Rv3709c	ask	0.992
Rv3709c	ask	0.992
Rv3709c	ask	0.992
Rv2753c	dapA	0.99
Rv3708c	asd	0.99
Rv3708c	asd	0.99
Rv1292	argS	0.986
Rv1292	argS	0.986
Rv1292	argS	0.986
Rv1296	thrB	0.983
Rv1296	thrB	0.983
Rv2192c	trpD	0.945
Rv2192c	trpD	0.945
Rv1659	argH	0.936
Rv1659	argH	0.936
Rv3838c	pheA	0.933
Rv3838c	pheA	0.933
Rv2158c	murE	0.932
Rv2158c	murE	0.932
Rv2158c	murE	0.932
Rv1656	argF	0.924
Rv1658	argG	0.924
Rv1656	argF	0.924
Rv2987c	leuD	0.92
Rv3423c	alr	0.92
Rv3423c	alr	0.92
Rv1652	argC	0.917
Rv1652	argC	0.917
Rv3290c	lat	0.904
Rv1202	dapE	0.901
Rv1202	dapE	0.901

Potential ligand/drug binding sites

Protein Model	Pocket Number	Drug Binding Site	PMIN Score	Pvalue PMIN	PMAX Score	Pvalue PMAX
Rv1293_2o0t_A	5	1s9p_DES_A_459 PDB CREDO	0.673	0.103	0.650	0.001
Rv1293_2o0t_A	5	2xkw_P1B_B_1475 PDB CREDO	0.638	0.137	0.638	0.001
Rv1293_2o0t_A	5	3bbt_FMM_D_91 PDB CREDO	0.705	0.077	0.635	0.001
Rv1293_2o0t_A	5	1mx1_THA_C_3 PDB CREDO	0.654	0.121	0.631	0.001
Rv1293_2o0t_A	5	3oht_1N1_B_1000 PDB CREDO	0.653	0.122	0.630	0.001
Rv1293_2o0t_A	5	3bbt_FMM_B_91 PDB CREDO	0.700	0.081	0.626	0.001
Rv1293_2o0t_A	5	3erd_DES_A_600 PDB CREDO	0.621	0.155	0.621	0.001
Rv1293_2o0t_A	5	3erd_DES_B_800 PDB CREDO	0.620	0.156	0.620	0.001
Rv1293_2o0t_A	5	1fm6_BRL_D_503 PDB CREDO	0.640	0.134	0.618	0.002
Rv1293_2o0t_A	5	1mx1_THA_E_5 PDB CREDO	0.635	0.140	0.612	0.002
Rv1293_2o0t_A	5	3oht_1N1_A_1000 PDB CREDO	0.655	0.119	0.609	0.002
Rv1293_2o0t_A	5	3adx_IMN_B_3 PDB CREDO	0.762	0.041	0.606	0.002
Rv1293_2o0t_A	5	2prg_BRL_A_1 PDB CREDO	0.627	0.149	0.605	0.002
Rv1293_2o0t_A	5	3h52_486_C_4 PDB CREDO	0.600	0.179	0.600	0.002
Rv1293_2o0t_A	5	1s9p_DES_D_600 PDB CREDO	0.621	0.154	0.600	0.002
Rv1293_2o0t_A	5	1zgy_BRL_A_503 PDB CREDO	0.687	0.091	0.598	0.002
Rv1293_2o0t_A	5	3rif_IVM_A_402 PDB CREDO	0.595	0.184	0.595	0.002
Rv1293_2o0t_A	5	3ri5_IVM_C_350 PDB CREDO	0.595	0.185	0.595	0.002
Rv1293_2o0t_A	5	3rif_IVM_B_403 PDB CREDO	0.595	0.185	0.595	0.002
Rv1293_2o0t_A	5	3spk_TPV_A_100 PDB CREDO	0.682	0.095	0.594	0.002
Rv1293_2o0t_A	5	3rif_IVM_D_402 PDB CREDO	0.594	0.187	0.594	0.002
Rv1293_2o0t_A	5	2fum_MIX_A_539 PDB CREDO	0.593	0.188	0.593	0.002
Rv1293_2o0t_A	5	3ria_IVM_C_349 PDB CREDO	0.593	0.188	0.593	0.002
Rv1293_2o0t_A	5	3qt0_486_A_4 PDB CREDO	0.658	0.117	0.592	0.002
Rv1293_2o0t_A	5	1gs4_ZK5_A_1918 PDB CREDO	0.592	0.189	0.592	0.002
Rv1293_2o0t_A	5	1jg2_ADN_A_500 PDB CREDO	0.634	0.140	0.591	0.002
Rv1293_2o0t_A	5	2h42_VIA_C_903 PDB CREDO	0.589	0.192	0.589	0.003
Rv1293_2o0t_A	5	1jg3_ADN_A_500 PDB CREDO	0.610	0.167	0.588	0.003
Rv1293_2o0t_A	5	2uxo_TAC_B_1211 PDB CREDO	0.737	0.055	0.586	0.003
Rv1293_2o0t_A	5	3rif_IVM_A_403 PDB CREDO	0.586	0.196	0.586	0.003
Rv1293_2o0t_A	5	1ya4_CTX_C_3 PDB CREDO	0.707	0.076	0.585	0.003
Rv1293_2o0t_A	5	2fum_MIX_D_3539 PDB CREDO	0.650	0.124	0.585	0.003
Rv1293_2o0t_A	5	3k54_1N1_A_1 PDB CREDO	0.605	0.173	0.583	0.003
Rv1293_2o0t_A	5	3gws_T3_X_500 PDB CREDO	0.716	0.069	0.583	0.003
Rv1293_2o0t_A	5	2h77_T3_A_1 PDB CREDO	0.669	0.107	0.582	0.003
Rv1293_2o0t_A	5	3jwq_VIA_B_901 PDB CREDO	0.581	0.203	0.581	0.003
Rv1293_2o0t_A	5	3h0a_9RA_A_500 PDB CREDO	0.642	0.133	0.577	0.003
Rv1293_2o0t_A	5	1mx1_THA_D_4 PDB CREDO	0.697	0.083	0.577	0.003
Rv1293_2o0t_A	5	1mx1_THA_F_6 PDB CREDO	0.696	0.084	0.577	0.003
Rv1293_2o0t_A	5	3oct_1N1_A_663 PDB CREDO	0.618	0.158	0.576	0.003
Rv1293_2o0t_A	5	1bsx_T3_B_2 PDB CREDO	0.706	0.076	0.575	0.003
Rv1293_2o0t_A	5	3jwq_VIA_D_901 PDB CREDO	0.638	0.136	0.575	0.003
Rv1293_2o0t_A	5	1bsx_T3_A_1 PDB CREDO	0.705	0.077	0.574	0.003
Rv1293_2o0t_A	5	1ya4_CTX_B_2 PDB CREDO	0.693	0.086	0.574	0.003
Rv1293_2o0t_A	5	1sqn_NDR_A_1001 PDB CREDO	0.595	0.185	0.574	0.003
Rv1293_2o0t_A	5	2prg_BRL_B_2 PDB CREDO	0.595	0.185	0.574	0.003
Rv1293_2o0t_A	5	3ln1_CEL_D_682 PDB CREDO	0.638	0.137	0.574	0.003
Rv1293_2o0t_A	5	1ya3_STR_A_1001 PDB CREDO	0.616	0.161	0.574	0.003
Rv1293_2o0t_A	5	2ito_IRE_A_2020 PDB CREDO	0.641	0.134	0.573	0.003
Rv1293_2o0t_A	5	2h79_T3_A_1 PDB CREDO	0.681	0.096	0.573	0.003
Rv1293_2o0t_A	5	1ya3_STR_C_3001 PDB CREDO	0.593	0.187	0.572	0.003
Rv1293_2o0t_A	5	1sqn_NDR_B_2001 PDB CREDO	0.592	0.189	0.571	0.004
Rv1293_2o0t_A	5	3ads_IMN_B_3 PDB CREDO	0.810	0.021	0.569	0.004
Rv1293_2o0t_A	5	1xzx_T3_X_500 PDB CREDO	0.721	0.066	0.568	0.004
Rv1293_2o0t_A	5	1ya3_STR_B_2001 PDB CREDO	0.609	0.168	0.567	0.004
Rv1293_2o0t_A	5	3uvv_T3_A_501 PDB CREDO	0.719	0.067	0.567	0.004
Rv1293_2o0t_A	5	2q1v_PDN_A_248 PDB CREDO	0.607	0.171	0.566	0.004
Rv1293_2o0t_A	5	3ols_EST_B_600 PDB CREDO	0.711	0.073	0.566	0.004
Rv1293_2o0t_A	5	2gqg_1N1_A_501 PDB CREDO	0.564	0.224	0.564	0.004
Rv1293_2o0t_A	5	3ols_EST_A_600 PDB CREDO	0.709	0.074	0.564	0.004
Rv1293_2o0t_A	5	2h42_VIA_A_901 PDB CREDO	0.627	0.149	0.564	0.004
Rv1293_2o0t_A	5	1g50_EST_A_600 PDB CREDO	0.709	0.074	0.564	0.004
Rv1293_2o0t_A	5	1s9p_DES_B_459 PDB CREDO	0.679	0.098	0.562	0.004
Rv1293_2o0t_A	5	1s9p_DES_C_500 PDB CREDO	0.678	0.098	0.562	0.004
Rv1293_2o0t_A	5	1a28_STR_A_1 PDB CREDO	0.578	0.206	0.558	0.004
Rv1293_2o0t_A	5	1nhz_486_A_800 PDB CREDO	0.641	0.134	0.558	0.004
Rv1293_2o0t_A	5	2cbr_A80_A_201 PDB CREDO	0.600	0.179	0.557	0.004
Rv1293_2o0t_A	5	3uud_EST_A_600 PDB CREDO	0.700	0.080	0.557	0.004
Rv1293_2o0t_A	5	3uud_EST_B_600 PDB CREDO	0.699	0.082	0.556	0.005
Rv1293_2o0t_A	5	2yja_EST_B_1550 PDB CREDO	0.698	0.082	0.555	0.005
Rv1293_2o0t_A	5	3ri5_IVM_A_349 PDB CREDO	0.617	0.159	0.552	0.005
Rv1293_2o0t_A	5	3sxr_1N1_A_1 PDB CREDO	0.667	0.109	0.552	0.005
Rv1293_2o0t_A	5	1fm6_BRL_X_504 PDB CREDO	0.698	0.082	0.550	0.005
Rv1293_2o0t_A	5	3qlg_1N1_A_601 PDB CREDO	0.638	0.137	0.549	0.005
Rv1293_2o0t_A	5	3rhw_IVM_A_348 PDB CREDO	0.614	0.163	0.549	0.005
Rv1293_2o0t_A	5	3ri5_IVM_D_349 PDB CREDO	0.613	0.164	0.549	0.005
Rv1293_2o0t_A	5	3g5d_1N1_A_1 PDB CREDO	0.637	0.138	0.548	0.005
Rv1293_2o0t_A	5	3ri5_IVM_B_349 PDB CREDO	0.612	0.164	0.548	0.005
Rv1293_2o0t_A	5	3rif_IVM_E_402 PDB CREDO	0.612	0.164	0.548	0.005
Rv1293_2o0t_A	5	2w8y_NDR_B_1000 PDB CREDO	0.661	0.114	0.547	0.005
Rv1293_2o0t_A	5	3rhw_IVM_D_349 PDB CREDO	0.612	0.165	0.547	0.005
Rv1293_2o0t_A	5	3g5d_1N1_B_1 PDB CREDO	0.635	0.140	0.547	0.005
Rv1293_2o0t_A	5	3rhw_IVM_D_348 PDB CREDO	0.611	0.166	0.547	0.005
Rv1293_2o0t_A	5	3ria_IVM_C_350 PDB CREDO	0.611	0.166	0.547	0.005
Rv1293_2o0t_A	5	3rhw_IVM_B_349 PDB CREDO	0.610	0.167	0.546	0.005
Rv1293_2o0t_A	5	2ity_IRE_A_2020 PDB CREDO	0.659	0.116	0.545	0.005
Rv1293_2o0t_A	5	3qlg_1N1_B_601 PDB CREDO	0.633	0.141	0.545	0.005
Rv1293_2o0t_A	5	3rhw_IVM_B_348 PDB CREDO	0.610	0.168	0.545	0.005
Rv1293_2o0t_A	5	3ria_IVM_A_348 PDB CREDO	0.610	0.168	0.545	0.005
Rv1293_2o0t_A	5	2h42_VIA_B_902 PDB CREDO	0.544	0.252	0.544	0.006
Rv1293_2o0t_A	5	3cs8_BRL_A_503 PDB CREDO	0.656	0.118	0.544	0.006
Rv1293_2o0t_A	5	3ria_IVM_E_349 PDB CREDO	0.607	0.171	0.543	0.006
Rv1293_2o0t_A	5	1p93_DEX_B_2999 PDB CREDO	0.603	0.176	0.542	0.006
Rv1293_2o0t_A	5	3f4x_KLT_A_300 PDB CREDO	0.604	0.174	0.541	0.006
Rv1293_2o0t_A	5	3kw2_ADN_B_300 PDB CREDO	0.653	0.121	0.541	0.006
Rv1293_2o0t_A	5	3ria_IVM_E_348 PDB CREDO	0.604	0.174	0.540	0.006
Rv1293_2o0t_A	3	2xkw_P1B_A_1478 PDB CREDO	0.552	0.241	0.538	0.006
Rv1293_2o0t_A	5	1p93_DEX_A_1999 PDB CREDO	0.597	0.183	0.537	0.006
Rv1293_2o0t_A	5	1jg3_ADN_B_550 PDB CREDO	0.624	0.152	0.537	0.006
Rv1293_2o0t_A	5	3o1c_ADN_A_127 PDB CREDO	0.556	0.236	0.536	0.006
Rv1293_2o0t_A	5	2aax_PDN_A_502 PDB CREDO	0.636	0.139	0.535	0.006
Rv1293_2o0t_A	5	1ie4_T44_B_328 PDB CREDO	0.621	0.155	0.534	0.006
Rv1293_2o0t_A	5	2zva_1N1_A_513 PDB CREDO	0.645	0.130	0.534	0.006
Rv1293_2o0t_A	5	3kw2_ADN_A_300 PDB CREDO	0.574	0.211	0.534	0.006
Rv1293_2o0t_A	5	1qkn_RAL_A_600 PDB CREDO	0.655	0.120	0.533	0.007
Rv1293_2o0t_A	5	2hw2_RFP_A_1200 PDB CREDO	0.697	0.083	0.533	0.007
Rv1293_2o0t_A	5	2y6o_1N1_A_1892 PDB CREDO	0.675	0.102	0.532	0.007
Rv1293_2o0t_A	5	1lhu_EST_A_301 PDB CREDO	0.551	0.242	0.532	0.007
Rv1293_2o0t_A	5	3sxr_1N1_B_2 PDB CREDO	0.669	0.107	0.532	0.007
Rv1293_2o0t_A	5	2aa6_STR_B_402 PDB CREDO	0.631	0.144	0.531	0.007
Rv1293_2o0t_A	5	2aax_PDN_B_503 PDB CREDO	0.631	0.144	0.531	0.007
Rv1293_2o0t_A	5	2aa6_STR_A_401 PDB CREDO	0.631	0.144	0.531	0.007
Rv1293_2o0t_A	5	1mx1_THA_A_1 PDB CREDO	0.720	0.066	0.527	0.007
Rv1293_2o0t_A	5	1z9y_FUN_A_500 PDB CREDO	0.589	0.192	0.527	0.007
Rv1293_2o0t_A	5	1cil_ETS_A_263 PDB CREDO	0.586	0.197	0.527	0.007
Rv1293_2o0t_A	3	3bjw_SVR_B_501 PDB CREDO	0.526	0.278	0.526	0.007
Rv1293_2o0t_A	5	2j7y_E3O_A_1454 PDB CREDO	0.588	0.194	0.526	0.007
Rv1293_2o0t_A	5	1mx1_THA_B_2 PDB CREDO	0.688	0.090	0.525	0.007
Rv1293_2o0t_A	5	4eb6_VLB_C_503 PDB CREDO	0.525	0.281	0.525	0.007
Rv1293_2o0t_A	5	3ln1_CEL_A_682 PDB CREDO	0.644	0.131	0.524	0.008
Rv1293_2o0t_A	5	1uwh_BAX_A_1723 PDB CREDO	0.729	0.061	0.523	0.008
Rv1293_2o0t_A	5	1uwh_BAX_B_1723 PDB CREDO	0.729	0.061	0.523	0.008
Rv1293_2o0t_A	5	3ln1_CEL_B_682 PDB CREDO	0.642	0.133	0.522	0.008
Rv1293_2o0t_A	5	2jfa_RAL_A_600 PDB CREDO	0.684	0.094	0.522	0.008
Rv1293_2o0t_A	5	3qgz_ADN_A_127 PDB CREDO	0.541	0.256	0.522	0.008
Rv1293_2o0t_A	5	3ln1_CEL_C_682 PDB CREDO	0.641	0.134	0.522	0.008
Rv1293_2o0t_A	5	2xpv_MIY_A_1209 PDB CREDO	0.541	0.257	0.522	0.008
Rv1293_2o0t_A	3	3bjw_SVR_F_502 PDB CREDO	0.522	0.285	0.522	0.008
Rv1293_2o0t_A	3	3bjw_SVR_B_512 PDB CREDO	0.521	0.285	0.521	0.008
Rv1293_2o0t_A	5	1ie4_T44_A_128 PDB CREDO	0.683	0.095	0.521	0.008
Rv1293_2o0t_A	5	2jfa_RAL_B_600 PDB CREDO	0.704	0.078	0.521	0.008
Rv1293_2o0t_A	3	3bjw_SVR_H_504 PDB CREDO	0.521	0.286	0.521	0.008
Rv1293_2o0t_A	5	1sn5_T3_C_601 PDB CREDO	0.711	0.073	0.521	0.008
Rv1293_2o0t_A	5	3lfa_1N1_A_361 PDB CREDO	0.711	0.073	0.521	0.008
Rv1293_2o0t_A	5	1err_RAL_A_600 PDB CREDO	0.700	0.081	0.518	0.008
Rv1293_2o0t_A	5	1err_RAL_B_600 PDB CREDO	0.700	0.081	0.518	0.008
Rv1293_2o0t_A	3	3bjw_SVR_C_505 PDB CREDO	0.560	0.230	0.518	0.008
Rv1293_2o0t_A	5	3d90_NOG_A_1001 PDB CREDO	0.594	0.186	0.517	0.008
Rv1293_2o0t_A	3	3bjw_SVR_E_503 PDB CREDO	0.559	0.231	0.517	0.008
Rv1293_2o0t_A	5	1y0x_T44_X_500 PDB CREDO	0.719	0.067	0.517	0.008
Rv1293_2o0t_A	5	1m17_AQ4_A_999 PDB CREDO	0.676	0.100	0.516	0.009
Rv1293_2o0t_A	5	3k2h_LYA_B_514 PDB CREDO	0.534	0.266	0.516	0.009
Rv1293_2o0t_A	5	3aod_RFP_C_2002 PDB CREDO	0.535	0.266	0.516	0.009
Rv1293_2o0t_A	5	4asd_BAX_A_1500 PDB CREDO	0.762	0.041	0.515	0.009
Rv1293_2o0t_A	5	3d90_NOG_B_2001 PDB CREDO	0.592	0.188	0.515	0.009
Rv1293_2o0t_A	5	3ri5_IVM_E_349 PDB CREDO	0.622	0.154	0.515	0.009
Rv1293_2o0t_A	5	2itz_IRE_A_2021 PDB CREDO	0.647	0.128	0.514	0.009
Rv1293_2o0t_A	3	1xkk_FMM_A_91 PDB CREDO	0.514	0.296	0.514	0.009
Rv1293_2o0t_A	5	4eyb_0WO_A_303 PDB CREDO	0.532	0.270	0.513	0.009
Rv1293_2o0t_A	5	1a28_STR_B_2 PDB CREDO	0.648	0.126	0.511	0.009
Rv1293_2o0t_A	5	1a27_EST_A_350 PDB CREDO	0.593	0.188	0.510	0.009
Rv1293_2o0t_A	3	3bjw_SVR_G_506 PDB CREDO	0.537	0.262	0.510	0.009
Rv1293_2o0t_A	5	1p93_DEX_D_4999 PDB CREDO	0.626	0.149	0.510	0.009
Rv1293_2o0t_A	5	3e22_LOC_D_700 PDB CREDO	0.666	0.109	0.509	0.010
Rv1293_2o0t_A	5	3e22_LOC_B_700 PDB CREDO	0.666	0.110	0.508	0.010
Rv1293_2o0t_A	5	1sn0_T44_C_601 PDB CREDO	0.790	0.029	0.508	0.010
Rv1293_2o0t_A	5	2fum_MIX_B_1539 PDB CREDO	0.638	0.137	0.507	0.010
Rv1293_2o0t_A	5	1p93_DEX_C_3999 PDB CREDO	0.623	0.153	0.507	0.010
Rv1293_2o0t_A	5	3ads_IMN_A_2 PDB CREDO	0.544	0.252	0.507	0.010
Rv1293_2o0t_A	5	3r9c_ECL_A_452 PDB CREDO	0.691	0.088	0.506	0.010
Rv1293_2o0t_A	5	3gn8_DEX_A_247 PDB CREDO	0.619	0.156	0.504	0.010
Rv1293_2o0t_A	5	3h52_486_D_2 PDB CREDO	0.701	0.080	0.503	0.010
Rv1293_2o0t_A	5	3mne_DEX_A_784 PDB CREDO	0.618	0.159	0.503	0.010
Rv1293_2o0t_A	5	4eyb_0WO_B_301 PDB CREDO	0.521	0.286	0.503	0.010
Rv1293_2o0t_A	5	3gn8_DEX_B_247 PDB CREDO	0.617	0.159	0.502	0.011
Rv1293_2o0t_A	5	3adx_IMN_A_2 PDB CREDO	0.502	0.315	0.502	0.011
Rv1293_2o0t_A	5	2aa5_STR_B_302 PDB CREDO	0.596	0.184	0.502	0.011
Rv1293_2o0t_A	5	3frq_ERY_B_195 PDB CREDO	0.656	0.119	0.501	0.011
Rv1293_2o0t_A	5	3oez_STI_B_601 PDB CREDO	0.656	0.119	0.501	0.011
Rv1293_2o0t_A	3	1uwj_BAX_A_1723 PDB CREDO	0.605	0.173	0.500	0.011
Rv1293_2o0t_A	5	1m2z_DEX_D_401 PDB CREDO	0.614	0.162	0.500	0.011

Similarity to known drug target from sensitive sequence analysis

No drug targets

List of small molecules tested from TIBLE

Data not available

Off-target activity - ligand based from TIBLE

Data not available

Small molecules involved in protein-protein complex from TIMBAL .Proteins similar to Mtb based on sequence analysis.

Data not available

STITCH interactions

Chemical Name	Confidence score	Molecular Weight
L-lysinePubChem	0.999	146.188
pyridoxal phosphatePubChem	0.994	247.142
diaminopimelic acidPubChem	0.991	190.197
meso-diaminopimelatePubChem	0.989	190.197
Nchembio861-comp5PubChem	0.968	377.33
SeMetPubChem	0.961	196.106
selenomethioninePubChem	0.961	196.106
ll-2,6-diaminopimelic acidPubChem	0.954	190.197
sulfatePubChem	0.948	96.0626
hydron sulfatePubChem	0.948	196.157
poly-L-lysine hydrobromidePubChem	0.918	146.188
deuteriumPubChem	0.917	2.01588
protiumPubChem	0.9	2.01576
H(+)PubChem	0.9	2.01588
carbon dioxidePubChem	0.9	44.0095
azelaic acidPubChem	0.879	188.221
dihydrodipicolinatePubChem	0.708	169.135
magnesiumPubChem	0.703	24.305