SInCRe - Rv2343c

Tuberculist information

Gene name	dnaG
Protein function	Probable DNA primase DnaG
Functional category(tuberculist)	information pathways
Gene location(kb)	2620.53
Molecular mass(da)	69593
External sites	TB Database TubercuList WebTB

Protein sequence

Number of amino acids : 639

	  		  	1    MSGRISDRDIAAIREGARIEDVVGDYVQLRRAGADSLKGLCPFHNEKSPSFHVRPNHGHF   60
			  	61   HCFGCGEGGDVYAFIQKIEHVSFVEAVELLADRIGHTISYTGAATSVQRDRGSRSRLLAA  120
			  	121  NAAAAAFYAQALQSDEAAPARQYLTERSFDAAAARKFGCGFAPSGWDSLTKHLQRKGFEF  180
			  	181  EELEAAGLSRQGRHGPMDRFHRRLLWPIRTSAGEVVGFGARRLFDDDAMEAKYVNTPETL  240
			  	241  LYKKSSVMFGIDLAKRDIAKGHQAVVVEGYTDVMAMHLAGVTTAVASCGTAFGGEHLAML  300
			  	301  RRLMMDDSFFRGELIYVFDGDEAGRAAALKAFDGEQKLAGQSFVAVAPDGMDPCDLRLKC  360
			  	361  GDAALRDLVARRTPLFEFAIRAAIAEMDLDSAEGRVAALRRCVPMVGQIKDPTLRDEYAR  420
			  	421  QLAGWVGWADVAQVIGRVRGEAKRTKHPRLGRLGSTTIARAAQRPTAGPPTELAVRPDPR  480
			  	481  DPTLWPQREALKSALQYPALAGPVFDALTVEGFTHPEYAAVRAAIDTAGGTSAGLSGAQW  540
			  	541  LDMVRQQTTSTVTSALISELGVEAIQVDDDKLPRYIAGVLARLQEVWLGRQIAEVKSKLQ  600
			  	601  RMSPIEQGDEYHALFGDLVAMEAYRRSLLEQASGDDLTA

Known structures in the PDB

No Known structures

Number of amino acids : 639

Domains assigned based on sequence.

Mtb Structural proteome models

CHOPIN models

Profile-based domain assignment

Structural/Functional domain family	Pfam acc.no./SCOP ID	Domain Region
zf-CHC2	PF01807	5-103
Toprim_N	PF08275	127-255
Toprim_4	PF13662	262-347
DnaB_bind	PF10410	375-433
DnaG_DnaB_bind	PF08278	486-615

Mtb Structural Proteome models

Model Number	1
Model name	Rv2343c
Template	2AU3 APDB CREDO
Template coverage	2_403
Template Identity(%)	30.8
Model coverage(%)	67.4
Normalized DOPE score	0.315

Model Number	2
Model name	Rv2343c.5
Template	1T3W APDB CREDO
Template coverage	447_579
Template Identity(%)	18.8
Model coverage(%)	21.3
Normalized DOPE score	0.491

Structure Models from Chopin

Model Number	1
Profile	e.13.1.1 Click for model details
zscore	52.62
Residue begin	116
Residue end	435

Model Number	2
Profile	g.41.3.2 - 3.90.580.10 Click for model details
zscore	24.98
Residue begin	5
Residue end	103

Model Number	3
Profile	c.136.1.1 - 3.40.1360.10 Click for model details
zscore	11.56
Residue begin	248
Residue end	368

Model Number	4
Profile	a.236.1.1 - 1.10.860.10 Click for model details
zscore	8.97
Residue begin	483
Residue end	620

Binding pockets

STRING

Cytoscape Web will replace the contents of this div with protein-protein interaction network.

Protein interacting with Rv2343c	Gene name	Confidence Score
Rv2703	sigA	0.984
Rv2703	sigA	0.984
Rv2703	sigA	0.984
Rv2703	sigA	0.984
Rv0058	dnaB	0.98
Rv0058	dnaB	0.98
Rv0058	dnaB	0.98
Rv0058	dnaB	0.98
Rv2344c	dgt	0.974
Rv2344c	dgt	0.974
Rv3715c	recR	0.97
Rv3715c	recR	0.97
Rv3715c	recR	0.97
Rv1001	arcA	0.966
Rv2710	sigB	0.965
Rv2710	sigB	0.965
Rv2710	sigB	0.965
Rv2710	sigB	0.965
Rv1848	ureA	0.964
Rv0668	rpoC	0.943
Rv0668	rpoC	0.943
Rv0668	rpoC	0.943
Rv0668	rpoC	0.943
Rv0668	rpoC	0.943
Rv0639	nusG	0.933
Rv0639	nusG	0.933
Rv0005	gyrB	0.929
Rv0005	gyrB	0.929
Rv0005	gyrB	0.929
Rv0005	gyrB	0.929
Rv2839c	infB	0.927
Rv2839c	infB	0.927
Rv2839c	infB	0.927
Rv2839c	infB	0.927
Rv0667	rpoB	0.92
Rv0667	rpoB	0.92
Rv0667	rpoB	0.92
Rv0667	rpoB	0.92
Rv0667	rpoB	0.92
Rv0667	rpoB	0.92
Rv2925c	rnc	0.916
Rv2925c	rnc	0.916
Rv2441c	rpmA	0.911
Rv1699	pyrG	0.902
Rv1699	pyrG	0.902

Potential ligand/drug binding sites

Protein Model	Pocket Number	Drug Binding Site	PMIN Score	Pvalue PMIN	PMAX Score	Pvalue PMAX
Rv2343c.5	3	3hbb_TMQ_A_611 PDB CREDO	0.642	0.132	0.642	0.001
Rv2343c.5	1	1qkn_RAL_A_600 PDB CREDO	0.678	0.099	0.635	0.001
Rv2343c.5	3	3clb_TMQ_B_612 PDB CREDO	0.663	0.112	0.633	0.001
Rv2343c.5	3	3clb_TMQ_C_613 PDB CREDO	0.632	0.142	0.632	0.001
Rv2343c.5	1	3h0a_9RA_A_500 PDB CREDO	0.649	0.125	0.628	0.001
Rv2343c.5	1	1nhz_486_A_800 PDB CREDO	0.627	0.148	0.627	0.001
Rv2343c.5	1	1s9p_DES_A_459 PDB CREDO	0.695	0.084	0.627	0.001
Rv2343c.5	1	3erd_DES_A_600 PDB CREDO	0.714	0.070	0.621	0.001
Rv2343c.5	1	2h77_T3_A_1 PDB CREDO	0.621	0.155	0.621	0.001
Rv2343c.5	1	1s9p_DES_D_600 PDB CREDO	0.685	0.092	0.618	0.001
Rv2343c.5	3	3vkx_T3_A_301 PDB CREDO	0.648	0.126	0.618	0.001
Rv2343c.5	3	3ug2_IRE_A_1 PDB CREDO	0.677	0.100	0.615	0.002
Rv2343c.5	1	1zgy_BRL_A_503 PDB CREDO	0.614	0.163	0.614	0.002
Rv2343c.5	1	1sqn_NDR_A_1001 PDB CREDO	0.678	0.099	0.611	0.002
Rv2343c.5	1	3gws_T3_X_500 PDB CREDO	0.653	0.122	0.611	0.002
Rv2343c.5	1	1sqn_NDR_B_2001 PDB CREDO	0.674	0.102	0.607	0.002
Rv2343c.5	1	3bbt_FMM_D_91 PDB CREDO	0.628	0.147	0.607	0.002
Rv2343c.5	3	3jw5_TOP_B_208 PDB CREDO	0.737	0.055	0.605	0.002
Rv2343c.5	1	2h79_T3_A_1 PDB CREDO	0.624	0.151	0.604	0.002
Rv2343c.5	3	3jw5_TOP_A_208 PDB CREDO	0.735	0.056	0.604	0.002
Rv2343c.5	3	3uq6_ADN_B_401 PDB CREDO	0.604	0.175	0.604	0.002
Rv2343c.5	1	1mx1_THA_C_3 PDB CREDO	0.669	0.106	0.603	0.002
Rv2343c.5	1	3d90_NOG_B_2001 PDB CREDO	0.603	0.175	0.603	0.002
Rv2343c.5	1	1gs4_ZK5_A_1918 PDB CREDO	0.693	0.086	0.603	0.002
Rv2343c.5	1	3d90_NOG_A_1001 PDB CREDO	0.602	0.176	0.602	0.002
Rv2343c.5	3	3uq6_ADN_A_401 PDB CREDO	0.601	0.177	0.601	0.002
Rv2343c.5	1	1bsx_T3_A_1 PDB CREDO	0.642	0.132	0.601	0.002
Rv2343c.5	1	1bsx_T3_B_2 PDB CREDO	0.642	0.132	0.601	0.002
Rv2343c.5	1	3ln1_CEL_D_682 PDB CREDO	0.621	0.154	0.601	0.002
Rv2343c.5	1	1xzx_T3_X_500 PDB CREDO	0.660	0.114	0.599	0.002
Rv2343c.5	1	3uvv_T3_A_501 PDB CREDO	0.660	0.115	0.598	0.002
Rv2343c.5	3	1xbb_STI_A_1 PDB CREDO	0.659	0.116	0.598	0.002
Rv2343c.5	1	2q1v_PDN_A_248 PDB CREDO	0.638	0.136	0.596	0.002
Rv2343c.5	1	3erd_DES_B_800 PDB CREDO	0.685	0.093	0.596	0.002
Rv2343c.5	1	2jfa_RAL_A_600 PDB CREDO	0.676	0.100	0.594	0.002
Rv2343c.5	3	2nnj_225_A_501 PDB CREDO	0.654	0.121	0.594	0.002
Rv2343c.5	1	1a28_STR_B_2 PDB CREDO	0.655	0.120	0.593	0.002
Rv2343c.5	1	1err_RAL_A_600 PDB CREDO	0.694	0.085	0.591	0.002
Rv2343c.5	1	1err_RAL_B_600 PDB CREDO	0.690	0.089	0.587	0.003
Rv2343c.5	1	1a28_STR_A_1 PDB CREDO	0.651	0.123	0.587	0.003
Rv2343c.5	3	1r9o_FLP_A_501 PDB CREDO	0.615	0.162	0.587	0.003
Rv2343c.5	1	1mx1_THA_E_5 PDB CREDO	0.698	0.082	0.586	0.003
Rv2343c.5	1	2aa6_STR_B_402 PDB CREDO	0.606	0.172	0.586	0.003
Rv2343c.5	1	2fum_MIX_D_3539 PDB CREDO	0.605	0.172	0.585	0.003
Rv2343c.5	1	2aa6_STR_A_401 PDB CREDO	0.605	0.173	0.585	0.003
Rv2343c.5	1	2aax_PDN_B_503 PDB CREDO	0.605	0.173	0.585	0.003
Rv2343c.5	3	1mx1_THA_A_1 PDB CREDO	0.730	0.060	0.584	0.003
Rv2343c.5	1	2aax_PDN_A_502 PDB CREDO	0.603	0.176	0.583	0.003
Rv2343c.5	1	3ln1_CEL_A_682 PDB CREDO	0.623	0.153	0.583	0.003
Rv2343c.5	1	1p93_DEX_B_2999 PDB CREDO	0.602	0.177	0.582	0.003
Rv2343c.5	3	3clb_TMQ_D_614 PDB CREDO	0.581	0.202	0.581	0.003
Rv2343c.5	1	3oct_1N1_A_663 PDB CREDO	0.623	0.153	0.581	0.003
Rv2343c.5	1	3ln1_CEL_B_682 PDB CREDO	0.621	0.155	0.581	0.003
Rv2343c.5	1	3ln1_CEL_C_682 PDB CREDO	0.621	0.155	0.581	0.003
Rv2343c.5	1	2jfa_RAL_B_600 PDB CREDO	0.682	0.095	0.581	0.003
Rv2343c.5	3	3grv_ADN_A_300 PDB CREDO	0.580	0.203	0.580	0.003
Rv2343c.5	3	2w9s_TOP_A_1160 PDB CREDO	0.706	0.076	0.579	0.003
Rv2343c.5	1	1p93_DEX_A_1999 PDB CREDO	0.599	0.180	0.579	0.003
Rv2343c.5	1	1fm6_BRL_X_504 PDB CREDO	0.638	0.136	0.579	0.003
Rv2343c.5	3	3hbb_TMQ_D_614 PDB CREDO	0.577	0.208	0.577	0.003
Rv2343c.5	3	3n8y_DIF_B_585 PDB CREDO	0.575	0.211	0.575	0.003
Rv2343c.5	1	1ya3_STR_A_1001 PDB CREDO	0.615	0.161	0.575	0.003
Rv2343c.5	1	1p93_DEX_C_3999 PDB CREDO	0.613	0.164	0.574	0.003
Rv2343c.5	1	3gn8_DEX_B_247 PDB CREDO	0.613	0.164	0.574	0.003
Rv2343c.5	3	2w9s_TOP_C_1160 PDB CREDO	0.698	0.083	0.573	0.003
Rv2343c.5	1	1p93_DEX_D_4999 PDB CREDO	0.611	0.166	0.572	0.003
Rv2343c.5	1	3gn8_DEX_A_247 PDB CREDO	0.611	0.166	0.572	0.003
Rv2343c.5	3	3clb_TMQ_A_611 PDB CREDO	0.654	0.120	0.571	0.004
Rv2343c.5	3	2uxp_CLM_B_1211 PDB CREDO	0.598	0.181	0.571	0.004
Rv2343c.5	1	3jwq_VIA_D_901 PDB CREDO	0.590	0.192	0.570	0.004
Rv2343c.5	3	3ads_IMN_B_3 PDB CREDO	0.682	0.095	0.570	0.004
Rv2343c.5	1	3mne_DEX_A_784 PDB CREDO	0.608	0.170	0.569	0.004
Rv2343c.5	1	1m2z_DEX_D_401 PDB CREDO	0.607	0.170	0.568	0.004
Rv2343c.5	3	3hbb_TMQ_C_613 PDB CREDO	0.651	0.123	0.568	0.004
Rv2343c.5	3	3fl9_TOP_A_200 PDB CREDO	0.692	0.087	0.568	0.004
Rv2343c.5	1	1m2z_DEX_A_301 PDB CREDO	0.607	0.171	0.568	0.004
Rv2343c.5	3	2bxf_DZP_A_2001 PDB CREDO	0.595	0.185	0.568	0.004
Rv2343c.5	3	2bxf_DZP_B_2001 PDB CREDO	0.595	0.185	0.568	0.004
Rv2343c.5	1	1fm6_BRL_D_503 PDB CREDO	0.629	0.146	0.567	0.004
Rv2343c.5	1	1y0x_T44_X_500 PDB CREDO	0.685	0.092	0.566	0.004
Rv2343c.5	1	2w8y_486_A_1000 PDB CREDO	0.727	0.062	0.565	0.004
Rv2343c.5	3	2uxp_CLM_A_1211 PDB CREDO	0.591	0.189	0.564	0.004
Rv2343c.5	3	3hm1_J3Z_A_2 PDB CREDO	0.591	0.189	0.564	0.004
Rv2343c.5	3	3hbb_TMQ_B_612 PDB CREDO	0.621	0.155	0.564	0.004
Rv2343c.5	1	1ya3_STR_B_2001 PDB CREDO	0.603	0.175	0.563	0.004
Rv2343c.5	3	2bdm_TMI_A_502 PDB CREDO	0.620	0.156	0.563	0.004
Rv2343c.5	1	2prg_BRL_B_2 PDB CREDO	0.621	0.155	0.560	0.004
Rv2343c.5	1	3h52_486_C_4 PDB CREDO	0.644	0.131	0.560	0.004
Rv2343c.5	3	3fl9_TOP_B_200 PDB CREDO	0.682	0.096	0.559	0.004
Rv2343c.5	1	3h52_486_A_3 PDB CREDO	0.676	0.100	0.558	0.004
Rv2343c.5	1	3qt0_486_A_4 PDB CREDO	0.576	0.209	0.557	0.004
Rv2343c.5	1	2gqg_1N1_B_502 PDB CREDO	0.575	0.210	0.556	0.005
Rv2343c.5	3	3fl9_TOP_G_200 PDB CREDO	0.677	0.099	0.556	0.005
Rv2343c.5	3	3adx_IMN_B_3 PDB CREDO	0.754	0.045	0.556	0.005
Rv2343c.5	3	1xoz_CIA_A_501 PDB CREDO	0.580	0.203	0.554	0.005
Rv2343c.5	3	1mx1_THA_D_4 PDB CREDO	0.781	0.033	0.553	0.005
Rv2343c.5	1	2h42_VIA_A_901 PDB CREDO	0.572	0.215	0.553	0.005
Rv2343c.5	1	2aa5_STR_B_302 PDB CREDO	0.571	0.216	0.552	0.005
Rv2343c.5	3	3mdv_CL6_A_506 PDB CREDO	0.578	0.206	0.552	0.005
Rv2343c.5	1	3oht_1N1_B_1000 PDB CREDO	0.612	0.165	0.551	0.005
Rv2343c.5	3	1uay_ADN_A_1001 PDB CREDO	0.577	0.208	0.551	0.005
Rv2343c.5	1	3spk_TPV_A_100 PDB CREDO	0.550	0.244	0.550	0.005
Rv2343c.5	1	2prg_BRL_A_1 PDB CREDO	0.610	0.168	0.550	0.005
Rv2343c.5	3	3b2r_VDN_A_1 PDB CREDO	0.602	0.176	0.549	0.005
Rv2343c.5	3	3r9c_ECL_A_451 PDB CREDO	0.669	0.106	0.549	0.005
Rv2343c.5	1	2gqg_1N1_A_501 PDB CREDO	0.631	0.144	0.549	0.005
Rv2343c.5	1	2h42_VIA_C_903 PDB CREDO	0.631	0.144	0.549	0.005
Rv2343c.5	1	3h52_486_D_2 PDB CREDO	0.665	0.110	0.549	0.005
Rv2343c.5	3	1pcg_EST_B_2 PDB CREDO	0.575	0.211	0.549	0.005
Rv2343c.5	3	3b2r_VDN_B_1 PDB CREDO	0.601	0.177	0.548	0.005
Rv2343c.5	3	1mx1_THA_F_6 PDB CREDO	0.774	0.035	0.548	0.005
Rv2343c.5	1	3heg_BAX_A_1 PDB CREDO	0.684	0.093	0.548	0.005
Rv2343c.5	3	1sn0_T44_C_601 PDB CREDO	0.600	0.179	0.547	0.005
Rv2343c.5	1	2j7y_E3O_A_1454 PDB CREDO	0.703	0.078	0.547	0.005
Rv2343c.5	3	2w3v_TOP_A_1169 PDB CREDO	0.574	0.212	0.547	0.005
Rv2343c.5	1	1mx1_THA_F_6 PDB CREDO	0.759	0.043	0.547	0.005
Rv2343c.5	1	2fum_MIX_A_539 PDB CREDO	0.629	0.146	0.547	0.005
Rv2343c.5	1	2aa5_STR_A_301 PDB CREDO	0.563	0.226	0.545	0.005
Rv2343c.5	1	2w8y_NDR_B_1000 PDB CREDO	0.756	0.044	0.545	0.005
Rv2343c.5	1	3bbt_FMM_B_91 PDB CREDO	0.700	0.081	0.545	0.005
Rv2343c.5	3	2w9h_TOP_A_1160 PDB CREDO	0.570	0.216	0.544	0.005
Rv2343c.5	1	1mx1_THA_D_4 PDB CREDO	0.753	0.046	0.542	0.006
Rv2343c.5	1	1uwh_BAX_A_1723 PDB CREDO	0.656	0.119	0.541	0.006
Rv2343c.5	1	1uwh_BAX_B_1723 PDB CREDO	0.656	0.119	0.541	0.006
Rv2343c.5	1	3nrr_D16_B_520 PDB CREDO	0.580	0.204	0.541	0.006
Rv2343c.5	3	3pgh_FLP_B_701 PDB CREDO	0.567	0.221	0.541	0.006
Rv2343c.5	3	3tmz_06X_A_503 PDB CREDO	0.648	0.127	0.541	0.006
Rv2343c.5	3	3fl9_TOP_C_200 PDB CREDO	0.694	0.085	0.540	0.006
Rv2343c.5	1	1s9p_DES_B_459 PDB CREDO	0.750	0.048	0.540	0.006
Rv2343c.5	1	1s9p_DES_C_500 PDB CREDO	0.748	0.049	0.539	0.006
Rv2343c.5	1	2oiq_STI_A_1001 PDB CREDO	0.671	0.105	0.537	0.006
Rv2343c.5	1	2cbr_A80_A_201 PDB CREDO	0.665	0.111	0.537	0.006
Rv2343c.5	3	1tbf_VIA_A_501 PDB CREDO	0.563	0.227	0.537	0.006
Rv2343c.5	1	2pl0_STI_A_200 PDB CREDO	0.671	0.105	0.537	0.006
Rv2343c.5	3	3tbg_RTZ_B_1 PDB CREDO	0.536	0.264	0.536	0.006
Rv2343c.5	1	2hw2_RFP_A_1200 PDB CREDO	0.610	0.167	0.536	0.006
Rv2343c.5	3	1mx1_THA_B_2 PDB CREDO	0.698	0.083	0.536	0.006
Rv2343c.5	3	2fum_MIX_C_2539 PDB CREDO	0.756	0.044	0.536	0.006
Rv2343c.5	1	2ab2_SNL_A_502 PDB CREDO	0.608	0.169	0.534	0.006
Rv2343c.5	1	3mno_DEX_A_784 PDB CREDO	0.628	0.147	0.534	0.006
Rv2343c.5	3	1ere_EST_B_600 PDB CREDO	0.559	0.231	0.534	0.006
Rv2343c.5	3	1gwr_EST_A_600 PDB CREDO	0.559	0.231	0.534	0.006
Rv2343c.5	3	1qku_EST_B_600 PDB CREDO	0.559	0.231	0.534	0.006
Rv2343c.5	3	1qku_EST_C_600 PDB CREDO	0.559	0.231	0.534	0.006
Rv2343c.5	1	2ab2_SNL_B_503 PDB CREDO	0.608	0.170	0.534	0.006
Rv2343c.5	3	1ere_EST_E_600 PDB CREDO	0.558	0.233	0.533	0.007
Rv2343c.5	3	1gwr_EST_B_600 PDB CREDO	0.558	0.233	0.533	0.007
Rv2343c.5	3	1qku_EST_A_600 PDB CREDO	0.558	0.233	0.533	0.007
Rv2343c.5	1	4asd_BAX_A_1500 PDB CREDO	0.685	0.093	0.532	0.007
Rv2343c.5	3	1ya4_CTX_C_3 PDB CREDO	0.751	0.047	0.532	0.007
Rv2343c.5	1	3mnp_DEX_A_784 PDB CREDO	0.625	0.151	0.532	0.007
Rv2343c.5	3	1ere_EST_A_600 PDB CREDO	0.557	0.234	0.532	0.007
Rv2343c.5	3	3jw3_TOP_A_208 PDB CREDO	0.762	0.041	0.532	0.007
Rv2343c.5	1	1d4s_TPV_A_201 PDB CREDO	0.531	0.272	0.531	0.007
Rv2343c.5	1	2x9g_LYA_B_1270 PDB CREDO	0.531	0.272	0.531	0.007
Rv2343c.5	1	2oax_SNL_C_3001 PDB CREDO	0.604	0.174	0.530	0.007
Rv2343c.5	1	3h52_486_B_1 PDB CREDO	0.662	0.113	0.530	0.007
Rv2343c.5	1	1ya3_STR_C_3001 PDB CREDO	0.632	0.143	0.530	0.007
Rv2343c.5	1	2yja_EST_B_1550 PDB CREDO	0.766	0.040	0.530	0.007
Rv2343c.5	1	3ols_EST_A_600 PDB CREDO	0.766	0.040	0.530	0.007
Rv2343c.5	1	1g50_EST_A_600 PDB CREDO	0.765	0.040	0.529	0.007
Rv2343c.5	3	3mdv_CL6_B_506 PDB CREDO	0.583	0.200	0.529	0.007
Rv2343c.5	1	3vn2_TLS_A_501 PDB CREDO	0.621	0.155	0.528	0.007
Rv2343c.5	1	2oax_SNL_B_2001 PDB CREDO	0.602	0.177	0.528	0.007
Rv2343c.5	1	3jwq_VIA_B_901 PDB CREDO	0.607	0.171	0.528	0.007
Rv2343c.5	1	3ols_EST_B_600 PDB CREDO	0.763	0.041	0.528	0.007
Rv2343c.5	1	3vhu_SNL_A_1001 PDB CREDO	0.601	0.178	0.528	0.007
Rv2343c.5	3	3bbt_FMM_B_91 PDB CREDO	0.805	0.023	0.528	0.007
Rv2343c.5	3	1g50_EST_B_1600 PDB CREDO	0.553	0.240	0.527	0.007
Rv2343c.5	3	2fum_MIX_B_1539 PDB CREDO	0.714	0.070	0.527	0.007
Rv2343c.5	3	3kw2_ADN_B_300 PDB CREDO	0.743	0.052	0.526	0.007
Rv2343c.5	1	3uud_EST_A_600 PDB CREDO	0.760	0.042	0.526	0.007
Rv2343c.5	1	3oez_STI_B_601 PDB CREDO	0.598	0.182	0.525	0.007
Rv2343c.5	3	2w9s_TOP_B_1160 PDB CREDO	0.710	0.073	0.524	0.008
Rv2343c.5	1	3uud_EST_B_600 PDB CREDO	0.757	0.044	0.524	0.008
Rv2343c.5	3	1xp0_VDN_A_201 PDB CREDO	0.627	0.148	0.524	0.008
Rv2343c.5	1	1uwj_BAX_B_1723 PDB CREDO	0.673	0.103	0.523	0.008
Rv2343c.5	1	2y6o_1N1_A_1892 PDB CREDO	0.577	0.208	0.523	0.008
Rv2343c.5	3	2w9g_TOP_A_1159 PDB CREDO	0.707	0.075	0.522	0.008
Rv2343c.5	3	3sxr_1N1_B_2 PDB CREDO	0.707	0.076	0.521	0.008
Rv2343c.5	3	1ya4_CTX_B_2 PDB CREDO	0.735	0.056	0.521	0.008
Rv2343c.5	1	2xkw_P1B_B_1475 PDB CREDO	0.598	0.181	0.520	0.008
Rv2343c.5	1	1ya4_CTX_C_3 PDB CREDO	0.721	0.066	0.519	0.008
Rv2343c.5	1	3ads_IMN_A_2 PDB CREDO	0.556	0.236	0.519	0.008
Rv2343c.5	1	3k54_1N1_A_1 PDB CREDO	0.618	0.159	0.518	0.008
Rv2343c.5	1	2hyy_STI_B_600 PDB CREDO	0.646	0.128	0.517	0.008
Rv2343c.5	3	3fl9_TOP_F_200 PDB CREDO	0.741	0.053	0.517	0.008
Rv2343c.5	1	1lhv_NOG_A_301 PDB CREDO	0.571	0.216	0.517	0.008
Rv2343c.5	3	1m17_AQ4_A_999 PDB CREDO	0.673	0.103	0.517	0.008
Rv2343c.5	3	1s9p_DES_C_500 PDB CREDO	0.730	0.060	0.517	0.008
Rv2343c.5	3	1dyr_TOP_A_407 PDB CREDO	0.597	0.182	0.516	0.009
Rv2343c.5	3	3s7s_EXM_A_601 PDB CREDO	0.516	0.294	0.516	0.009
Rv2343c.5	3	1g50_EST_A_600 PDB CREDO	0.700	0.081	0.516	0.009
Rv2343c.5	3	1wrk_TFP_A_202 PDB CREDO	0.540	0.258	0.516	0.009
Rv2343c.5	1	2x9g_LYA_A_1270 PDB CREDO	0.568	0.219	0.515	0.009
Rv2343c.5	3	1qhs_CLM_A_999 PDB CREDO	0.567	0.221	0.515	0.009
Rv2343c.5	1	1ya4_CTX_B_2 PDB CREDO	0.715	0.070	0.515	0.009
Rv2343c.5	1	2x2n_X2N_C_1479 PDB CREDO	0.532	0.269	0.515	0.009
Rv2343c.5	3	1s9p_DES_B_459 PDB CREDO	0.726	0.062	0.515	0.009
Rv2343c.5	3	3sxr_1N1_A_1 PDB CREDO	0.726	0.062	0.515	0.009
Rv2343c.5	1	3cs9_NIL_A_600 PDB CREDO	0.764	0.040	0.514	0.009
Rv2343c.5	3	3gvu_STI_A_1002 PDB CREDO	0.695	0.085	0.513	0.009
Rv2343c.5	1	3v5w_8PR_A_701 PDB CREDO	0.547	0.248	0.512	0.009
Rv2343c.5	1	1mx1_THA_B_2 PDB CREDO	0.770	0.037	0.512	0.009
Rv2343c.5	3	2yja_EST_B_1550 PDB CREDO	0.694	0.085	0.512	0.009
Rv2343c.5	3	2jap_J01_A_1249 PDB CREDO	0.537	0.263	0.512	0.009
Rv2343c.5	3	1qhy_CLM_A_999 PDB CREDO	0.562	0.227	0.511	0.009
Rv2343c.5	3	2w3a_TOP_A_1190 PDB CREDO	0.535	0.265	0.511	0.009
Rv2343c.5	3	3ols_EST_B_600 PDB CREDO	0.692	0.087	0.510	0.009
Rv2343c.5	1	2x9g_LYA_C_1270 PDB CREDO	0.546	0.250	0.510	0.009
Rv2343c.5	3	2jap_J01_C_1249 PDB CREDO	0.534	0.266	0.509	0.009
Rv2343c.5	3	2uxo_TAC_B_1211 PDB CREDO	0.691	0.088	0.509	0.009
Rv2343c.5	1	2h42_VIA_B_902 PDB CREDO	0.585	0.197	0.509	0.009
Rv2343c.5	1	2x2n_X2N_B_1479 PDB CREDO	0.580	0.204	0.509	0.010
Rv2343c.5	3	3ols_EST_A_600 PDB CREDO	0.690	0.089	0.509	0.010
Rv2343c.5	1	2x9g_LYA_D_1270 PDB CREDO	0.544	0.252	0.508	0.010
Rv2343c.5	3	2jap_J01_B_1249 PDB CREDO	0.533	0.268	0.508	0.010
Rv2343c.5	3	2jap_J01_D_1249 PDB CREDO	0.533	0.268	0.508	0.010
Rv2343c.5	3	1sn5_T3_D_602 PDB CREDO	0.557	0.234	0.508	0.010
Rv2343c.5	3	1mrl_DOL_A_300 PDB CREDO	0.635	0.140	0.508	0.010
Rv2343c.5	3	2eva_ADN_A_498 PDB CREDO	0.559	0.232	0.507	0.010
Rv2343c.5	1	2qxs_RAL_A_600 PDB CREDO	0.773	0.036	0.506	0.010
Rv2343c.5	1	3oht_1N1_A_1000 PDB CREDO	0.626	0.149	0.506	0.010
Rv2343c.5	1	3gcs_BAX_A_401 PDB CREDO	0.651	0.123	0.506	0.010
Rv2343c.5	3	3uud_EST_A_600 PDB CREDO	0.687	0.091	0.506	0.010
Rv2343c.5	3	3uud_EST_B_600 PDB CREDO	0.687	0.091	0.506	0.010
Rv2343c.5	1	2oax_SNL_D_4001 PDB CREDO	0.632	0.143	0.506	0.010
Rv2343c.5	1	2x2n_X2N_A_1480 PDB CREDO	0.576	0.209	0.506	0.010
Rv2343c.5	3	2w8y_NDR_B_1000 PDB CREDO	0.714	0.070	0.506	0.010
Rv2343c.5	3	3mdt_VOR_A_506 PDB CREDO	0.649	0.126	0.505	0.010
Rv2343c.5	1	2oax_SNL_F_6001 PDB CREDO	0.630	0.145	0.504	0.010
Rv2343c.5	1	2qxs_RAL_B_600 PDB CREDO	0.769	0.038	0.504	0.010
Rv2343c.5	3	2jj8_AZZ_A_1211 PDB CREDO	0.504	0.312	0.504	0.010
Rv2343c.5	1	2oax_SNL_A_1001 PDB CREDO	0.629	0.146	0.504	0.010
Rv2343c.5	1	3cs9_NIL_B_600 PDB CREDO	0.767	0.039	0.503	0.010
Rv2343c.5	3	2w9s_TOP_E_1160 PDB CREDO	0.582	0.201	0.503	0.010
Rv2343c.5	3	2w9s_TOP_D_1158 PDB CREDO	0.628	0.147	0.503	0.010
Rv2343c.5	1	2oax_SNL_E_5001 PDB CREDO	0.628	0.147	0.502	0.011
Rv2343c.5	3	3nrr_D16_A_520 PDB CREDO	0.576	0.209	0.502	0.011
Rv2343c.5	1	1a27_EST_A_350 PDB CREDO	0.670	0.105	0.502	0.011
Rv2343c.5	3	1sn5_T3_C_601 PDB CREDO	0.626	0.150	0.501	0.011
Rv2343c.5	3	3mdt_VOR_B_506 PDB CREDO	0.643	0.131	0.501	0.011
Rv2343c.5	3	3tbg_RTZ_D_1 PDB CREDO	0.525	0.280	0.501	0.011

Similarity to known drug target from sensitive sequence analysis

No drug targets

List of small molecules tested from TIBLE

Data not available

Off-target activity - ligand based from TIBLE

Data not available

Small molecules involved in protein-protein complex from TIMBAL .Proteins similar to Mtb based on sequence analysis.

Data not available

STITCH interactions

No high confidence interactions