Rv3266c
Tuberculist information
| Gene name | rmlD |
| Protein function | dTDP-6-deoxy-L-lyxo-4-hexulose reductase RmlD (dTDP-rhamnose modification protein) (dTDP-rhamnose biosynthesis protein) (dTDP-rhamnose synthase) |
| Functional category(tuberculist) | intermediary metabolism and respiration |
| Gene location(kb) | 3646.9 |
| Molecular mass(da) | 32044.8 |
| External sites | TB Database TubercuList WebTB |
|---|
Protein sequence
Number of amino acids : 304
1 MAGRSERLVITGAGGQLGSHLTAQAAREGRDMLALTSSQWDITDPAAAERIIRHGDVVIN 60 61 CAAYTDVDGAESNEAVAYAVNATGPQHLARACARVGARLIHVSTDYVFDGDFGGAEPRPY 120 121 EPTDETAPQGVYARSKLAGEQAVLAAFPEAAVVRTAWVYTGGTGKDFVAVMRRLAAGHGR 180 181 VDVVDDQTGSPTYVADLAEALLALADAGVRGRVLHAANEGVVSRFGQARAVFEECGADPQ 240 241 RVRPVSSAQFPRPAPRSSYSALSSRQWALAGLTPLRHWRSALATALAAPANSTSIDRRLP 300 301 STRD
Known structures in the PDB
No Known structures
Number of amino acids : 304
Domains assigned based on sequence.
Mtb Structural proteome models
CHOPIN models
Domains assigned based on sequence. Mtb Structural proteome models CHOPIN models| Structural/Functional domain family | Pfam acc.no./SCOP ID | Domain Region | |
|---|---|---|---|
| RmlD_sub_bind | PF04321 | 6-291 |
| Model Number | 1 |
| Profile | c.2.1.2 - 3.40.50.720 Click for model details |
|---|---|
| zscore | 10 |
| Residue begin | 1 |
| Residue end | 304 |
Cytoscape Web will replace the contents of this div with protein-protein interaction network.
| Protein interacting with Rv3266c | Gene name | Confidence Score |
|---|---|---|
| Rv3465 | rmlC | 0.999 |
| Rv0334 | rmlA | 0.997 |
| Rv3265c | wbbL1 | 0.993 |
| Rv3809c | glf | 0.977 |
| Rv3809c | glf | 0.977 |
| Rv3264c | manB | 0.97 |
| Rv3264c | manB | 0.97 |
| Rv3634c | galE1 | 0.939 |
| Rv0993 | galU | 0.936 |
| Rv3464 | rmlB | 0.935 |
| Rv1511 | gmdA | 0.93 |
| Rv1512 | epiA | 0.919 |
| Rv2555c | alaS | 0.901 |
| Rv2555c | alaS | 0.901 |
| Rv2555c | alaS | 0.901 |
View results in TIBLE page
| Name | Affinity | Assay description | DOI |
|---|---|---|---|
| CHEMBL1094496 | Not Active | Inhibition of Mycobacterium tuberculosis RmlD assessed as inhibition of dTDP-beta-6-deoxy-L-lyxo-4-hexulose to dTDP-beta-L-rhamnose conversion at 10 ug/ml | http://www.ncbi.nlm.nih.gov/pubmed/22014548 |
| CHEMBL1200847 | Not Active | Inhibition of Mycobacterium tuberculosis RmlD assessed as inhibition of dTDP-beta-6-deoxy-L-lyxo-4-hexulose to dTDP-beta-L-rhamnose conversion at 10 ug/ml | http://www.ncbi.nlm.nih.gov/pubmed/22014548 |
| CHEMBL1329443 | Not Active | Inhibition of Mycobacterium tuberculosis RmlD assessed as inhibition of dTDP-beta-6-deoxy-L-lyxo-4-hexulose to dTDP-beta-L-rhamnose conversion at 10 ug/ml | http://www.ncbi.nlm.nih.gov/pubmed/22014548 |
| CHEMBL1336888 | Not Active | Inhibition of Mycobacterium tuberculosis RmlD assessed as inhibition of dTDP-beta-6-deoxy-L-lyxo-4-hexulose to dTDP-beta-L-rhamnose conversion at 10 ug/ml | http://www.ncbi.nlm.nih.gov/pubmed/22014548 |
| CHEMBL1368535 | Not Active | Inhibition of Mycobacterium tuberculosis RmlD assessed as inhibition of dTDP-beta-6-deoxy-L-lyxo-4-hexulose to dTDP-beta-L-rhamnose conversion at 10 ug/ml | http://www.ncbi.nlm.nih.gov/pubmed/22014548 |
| CHEMBL1372046 | Not Active | Inhibition of Mycobacterium tuberculosis RmlD assessed as inhibition of dTDP-beta-6-deoxy-L-lyxo-4-hexulose to dTDP-beta-L-rhamnose conversion at 10 ug/ml | http://www.ncbi.nlm.nih.gov/pubmed/22014548 |
| CHEMBL1373396 | Not Active | Inhibition of Mycobacterium tuberculosis RmlD assessed as inhibition of dTDP-beta-6-deoxy-L-lyxo-4-hexulose to dTDP-beta-L-rhamnose conversion at 10 ug/ml | http://www.ncbi.nlm.nih.gov/pubmed/22014548 |
| CHEMBL1374370 | Not Active | Inhibition of Mycobacterium tuberculosis RmlD assessed as inhibition of dTDP-beta-6-deoxy-L-lyxo-4-hexulose to dTDP-beta-L-rhamnose conversion at 10 ug/ml | http://www.ncbi.nlm.nih.gov/pubmed/22014548 |
| CHEMBL1413910 | Not Active | Inhibition of Mycobacterium tuberculosis RmlD assessed as inhibition of dTDP-beta-6-deoxy-L-lyxo-4-hexulose to dTDP-beta-L-rhamnose conversion at 10 ug/ml | http://www.ncbi.nlm.nih.gov/pubmed/22014548 |
| CHEMBL1421307 | Not Active | Inhibition of Mycobacterium tuberculosis RmlD assessed as inhibition of dTDP-beta-6-deoxy-L-lyxo-4-hexulose to dTDP-beta-L-rhamnose conversion at 10 ug/ml | http://www.ncbi.nlm.nih.gov/pubmed/22014548 |
| CHEMBL1448304 | Not Active | Inhibition of Mycobacterium tuberculosis RmlD assessed as inhibition of dTDP-beta-6-deoxy-L-lyxo-4-hexulose to dTDP-beta-L-rhamnose conversion at 10 ug/ml | http://www.ncbi.nlm.nih.gov/pubmed/22014548 |
| CHEMBL144924 | Not Active | Inhibition of Mycobacterium tuberculosis RmlD assessed as inhibition of dTDP-beta-6-deoxy-L-lyxo-4-hexulose to dTDP-beta-L-rhamnose conversion at 10 ug/ml | http://www.ncbi.nlm.nih.gov/pubmed/22014548 |
| CHEMBL1456848 | Not Active | Inhibition of Mycobacterium tuberculosis RmlD assessed as inhibition of dTDP-beta-6-deoxy-L-lyxo-4-hexulose to dTDP-beta-L-rhamnose conversion at 10 ug/ml | http://www.ncbi.nlm.nih.gov/pubmed/22014548 |
| CHEMBL1486811 | Not Active | Inhibition of Mycobacterium tuberculosis RmlD assessed as inhibition of dTDP-beta-6-deoxy-L-lyxo-4-hexulose to dTDP-beta-L-rhamnose conversion at 10 ug/ml | http://www.ncbi.nlm.nih.gov/pubmed/22014548 |
| CHEMBL1519374 | Not Active | Inhibition of Mycobacterium tuberculosis RmlD assessed as inhibition of dTDP-beta-6-deoxy-L-lyxo-4-hexulose to dTDP-beta-L-rhamnose conversion at 10 ug/ml | http://www.ncbi.nlm.nih.gov/pubmed/22014548 |
| CHEMBL1543865 | Not Active | Inhibition of Mycobacterium tuberculosis RmlD assessed as inhibition of dTDP-beta-6-deoxy-L-lyxo-4-hexulose to dTDP-beta-L-rhamnose conversion at 10 ug/ml | http://www.ncbi.nlm.nih.gov/pubmed/22014548 |
| CHEMBL1555233 | Not Active | Inhibition of Mycobacterium tuberculosis RmlD assessed as inhibition of dTDP-beta-6-deoxy-L-lyxo-4-hexulose to dTDP-beta-L-rhamnose conversion at 10 ug/ml | http://www.ncbi.nlm.nih.gov/pubmed/22014548 |
| CHEMBL1561747 | Not Active | Inhibition of Mycobacterium tuberculosis RmlD assessed as inhibition of dTDP-beta-6-deoxy-L-lyxo-4-hexulose to dTDP-beta-L-rhamnose conversion at 10 ug/ml | http://www.ncbi.nlm.nih.gov/pubmed/22014548 |
| CHEMBL1601846 | Not Active | Inhibition of Mycobacterium tuberculosis RmlD assessed as inhibition of dTDP-beta-6-deoxy-L-lyxo-4-hexulose to dTDP-beta-L-rhamnose conversion at 10 ug/ml | http://www.ncbi.nlm.nih.gov/pubmed/22014548 |
| CHEMBL1651364 | Not Active | Inhibition of Mycobacterium tuberculosis RmlD assessed as inhibition of dTDP-beta-6-deoxy-L-lyxo-4-hexulose to dTDP-beta-L-rhamnose conversion at 10 ug/ml | http://www.ncbi.nlm.nih.gov/pubmed/22014548 |
| CHEMBL1707907 | Not Active | Inhibition of Mycobacterium tuberculosis RmlD assessed as inhibition of dTDP-beta-6-deoxy-L-lyxo-4-hexulose to dTDP-beta-L-rhamnose conversion at 10 ug/ml | http://www.ncbi.nlm.nih.gov/pubmed/22014548 |
| CHEMBL171699 | Not Active | Inhibition of Mycobacterium tuberculosis RmlD assessed as inhibition of dTDP-beta-6-deoxy-L-lyxo-4-hexulose to dTDP-beta-L-rhamnose conversion at 10 ug/ml | http://www.ncbi.nlm.nih.gov/pubmed/22014548 |
| CHEMBL1728978 | Not Active | Inhibition of Mycobacterium tuberculosis RmlD assessed as inhibition of dTDP-beta-6-deoxy-L-lyxo-4-hexulose to dTDP-beta-L-rhamnose conversion at 10 ug/ml | http://www.ncbi.nlm.nih.gov/pubmed/22014548 |
| CHEMBL175266 | IC50 = 15 uM | Inhibition of Mycobacterium tuberculosis RmlD assessed as inhibition of dTDP-beta-6-deoxy-L-lyxo-4-hexulose to dTDP-beta-L-rhamnose conversion | http://www.ncbi.nlm.nih.gov/pubmed/22014548 |
| CHEMBL1903665 | Not Active | Inhibition of Mycobacterium tuberculosis RmlD assessed as inhibition of dTDP-beta-6-deoxy-L-lyxo-4-hexulose to dTDP-beta-L-rhamnose conversion at 10 ug/ml | http://www.ncbi.nlm.nih.gov/pubmed/22014548 |
| CHEMBL1939685 | IC50 = 2.1 uM | Inhibition of Mycobacterium tuberculosis RmlD assessed as inhibition of dTDP-beta-6-deoxy-L-lyxo-4-hexulose to dTDP-beta-L-rhamnose conversion | http://www.ncbi.nlm.nih.gov/pubmed/22014548 |
| CHEMBL1939686 | Not Active | Inhibition of Mycobacterium tuberculosis RmlD assessed as inhibition of dTDP-beta-6-deoxy-L-lyxo-4-hexulose to dTDP-beta-L-rhamnose conversion at 10 ug/ml | http://www.ncbi.nlm.nih.gov/pubmed/22014548 |
| CHEMBL1939687 | Not Active | Inhibition of Mycobacterium tuberculosis RmlD assessed as inhibition of dTDP-beta-6-deoxy-L-lyxo-4-hexulose to dTDP-beta-L-rhamnose conversion at 10 ug/ml | http://www.ncbi.nlm.nih.gov/pubmed/22014548 |
| CHEMBL1939688 | Not Active | Inhibition of Mycobacterium tuberculosis RmlD assessed as inhibition of dTDP-beta-6-deoxy-L-lyxo-4-hexulose to dTDP-beta-L-rhamnose conversion at 10 ug/ml | http://www.ncbi.nlm.nih.gov/pubmed/22014548 |
| CHEMBL1939689 | Not Active | Inhibition of Mycobacterium tuberculosis RmlD assessed as inhibition of dTDP-beta-6-deoxy-L-lyxo-4-hexulose to dTDP-beta-L-rhamnose conversion at 10 ug/ml | http://www.ncbi.nlm.nih.gov/pubmed/22014548 |
| CHEMBL1939690 | Not Active | Inhibition of Mycobacterium tuberculosis RmlD assessed as inhibition of dTDP-beta-6-deoxy-L-lyxo-4-hexulose to dTDP-beta-L-rhamnose conversion at 10 ug/ml | http://www.ncbi.nlm.nih.gov/pubmed/22014548 |
| CHEMBL1939691 | Not Active | Inhibition of Mycobacterium tuberculosis RmlD assessed as inhibition of dTDP-beta-6-deoxy-L-lyxo-4-hexulose to dTDP-beta-L-rhamnose conversion at 10 ug/ml | http://www.ncbi.nlm.nih.gov/pubmed/22014548 |
| CHEMBL1939837 | Not Active | Inhibition of Mycobacterium tuberculosis RmlD assessed as inhibition of dTDP-beta-6-deoxy-L-lyxo-4-hexulose to dTDP-beta-L-rhamnose conversion at 10 ug/ml | http://www.ncbi.nlm.nih.gov/pubmed/22014548 |
| CHEMBL1939838 | Not Active | Inhibition of Mycobacterium tuberculosis RmlD assessed as inhibition of dTDP-beta-6-deoxy-L-lyxo-4-hexulose to dTDP-beta-L-rhamnose conversion at 10 ug/ml | http://www.ncbi.nlm.nih.gov/pubmed/22014548 |
| CHEMBL1939839 | Not Active | Inhibition of Mycobacterium tuberculosis RmlD assessed as inhibition of dTDP-beta-6-deoxy-L-lyxo-4-hexulose to dTDP-beta-L-rhamnose conversion at 10 ug/ml | http://www.ncbi.nlm.nih.gov/pubmed/22014548 |
| CHEMBL1939840 | Not Active | Inhibition of Mycobacterium tuberculosis RmlD assessed as inhibition of dTDP-beta-6-deoxy-L-lyxo-4-hexulose to dTDP-beta-L-rhamnose conversion at 10 ug/ml | http://www.ncbi.nlm.nih.gov/pubmed/22014548 |
| CHEMBL1939841 | Not Active | Inhibition of Mycobacterium tuberculosis RmlD assessed as inhibition of dTDP-beta-6-deoxy-L-lyxo-4-hexulose to dTDP-beta-L-rhamnose conversion at 10 ug/ml | http://www.ncbi.nlm.nih.gov/pubmed/22014548 |
| CHEMBL1939842 | Not Active | Inhibition of Mycobacterium tuberculosis RmlD assessed as inhibition of dTDP-beta-6-deoxy-L-lyxo-4-hexulose to dTDP-beta-L-rhamnose conversion at 10 ug/ml | http://www.ncbi.nlm.nih.gov/pubmed/22014548 |
| CHEMBL1939843 | Not Active | Inhibition of Mycobacterium tuberculosis RmlD assessed as inhibition of dTDP-beta-6-deoxy-L-lyxo-4-hexulose to dTDP-beta-L-rhamnose conversion at 10 ug/ml | http://www.ncbi.nlm.nih.gov/pubmed/22014548 |
| CHEMBL194772 | Not Active | Inhibition of Mycobacterium tuberculosis RmlD assessed as inhibition of dTDP-beta-6-deoxy-L-lyxo-4-hexulose to dTDP-beta-L-rhamnose conversion at 10 ug/ml | http://www.ncbi.nlm.nih.gov/pubmed/22014548 |
| CHEMBL205119 | IC50 = 25 uM | Inhibition of Mycobacterium tuberculosis RmlD assessed as inhibition of dTDP-beta-6-deoxy-L-lyxo-4-hexulose to dTDP-beta-L-rhamnose conversion | http://www.ncbi.nlm.nih.gov/pubmed/22014548 |
| CHEMBL279151 | Not Active | Inhibition of Mycobacterium tuberculosis RmlD assessed as inhibition of dTDP-beta-6-deoxy-L-lyxo-4-hexulose to dTDP-beta-L-rhamnose conversion at 10 ug/ml | http://www.ncbi.nlm.nih.gov/pubmed/22014548 |
| CHEMBL313244 | Not Active | Inhibition of Mycobacterium tuberculosis RmlD assessed as inhibition of dTDP-beta-6-deoxy-L-lyxo-4-hexulose to dTDP-beta-L-rhamnose conversion at 10 ug/ml | http://www.ncbi.nlm.nih.gov/pubmed/22014548 |
| CHEMBL375328 | IC50 = 0.9 uM | Inhibition of Mycobacterium tuberculosis RmlD assessed as inhibition of dTDP-beta-6-deoxy-L-lyxo-4-hexulose to dTDP-beta-L-rhamnose conversion | http://www.ncbi.nlm.nih.gov/pubmed/22014548 |
| CHEMBL38650 | Not Active | Inhibition of Mycobacterium tuberculosis RmlD assessed as inhibition of dTDP-beta-6-deoxy-L-lyxo-4-hexulose to dTDP-beta-L-rhamnose conversion at 10 ug/ml | http://www.ncbi.nlm.nih.gov/pubmed/22014548 |
| CHEMBL487258 | Not Active | Inhibition of Mycobacterium tuberculosis RmlD assessed as inhibition of dTDP-beta-6-deoxy-L-lyxo-4-hexulose to dTDP-beta-L-rhamnose conversion at 10 ug/ml | http://www.ncbi.nlm.nih.gov/pubmed/22014548 |
| CHEMBL502775 | Not Active | Inhibition of Mycobacterium tuberculosis RmlD assessed as inhibition of dTDP-beta-6-deoxy-L-lyxo-4-hexulose to dTDP-beta-L-rhamnose conversion at 10 ug/ml | http://www.ncbi.nlm.nih.gov/pubmed/22014548 |
| CHEMBL52 | Not Active | Inhibition of Mycobacterium tuberculosis RmlD assessed as inhibition of dTDP-beta-6-deoxy-L-lyxo-4-hexulose to dTDP-beta-L-rhamnose conversion at 10 ug/ml | http://www.ncbi.nlm.nih.gov/pubmed/22014548 |
| CHEMBL522983 | Not Active | Inhibition of Mycobacterium tuberculosis RmlD assessed as inhibition of dTDP-beta-6-deoxy-L-lyxo-4-hexulose to dTDP-beta-L-rhamnose conversion at 10 ug/ml | http://www.ncbi.nlm.nih.gov/pubmed/22014548 |
View results in TIBLE page
| Predicted off-target | Method | Summary | Full results |
|---|---|---|---|
| Insulin receptor 2AUH | PharmMapper | 3 hydroph + 5 HB + 3 pos/neg + 0 arom | Link |
| Glutathione S-transferase P 11GS | PharmMapper | 5 hydroph + 1 HB + 1 pos/neg + 0 arom | Link |
| Tyrosine-protein phosphatase non-receptor type 1 1NWL | PharmMapper | 3 hydroph + 5 HB + 0 pos/neg + 0 arom | Link |
| Retinoic acid receptor RXR-beta 1H9U | PharmMapper | 8 hydroph + 1 HB + 1 pos/neg + 0 arom | Link |
| Dual specificity mitogen-activated protein kinase kinase 1 1S9J | PharmMapper | 7 hydroph + 2 HB + 0 pos/neg + 0 arom | Link |
| Peroxidase | PASS | Pa = 0.856 & SM = CHEMBL175266 | Link |
| Aldehyde oxidase | PASS | Pa = 0.819 & SM = CHEMBL175266 | Link |
| JAK2 expression | PASS | Pa = 0.815 & SM = CHEMBL175266 | Link |
| Insulysin | PASS | Pa = 0.742 & SM = CHEMBL175266 | Link |
| AR expression | PASS | Pa = 0.701 & SM = CHEMBL175266 | Link |
| cyclin-dependent kinase 6 [-] | SEA | E_value = 3.67e-28 & MaxTC = 0.44 | Link |
| 3-oxoacyl-acyl-carrier protein reductase | SEA | E_value = 6.72e-26 & MaxTC = 0.44 | Link |
| N-acetyl-beta-glucosaminidase [-] | SEA | E_value = 6.7e-24 & MaxTC = 0.5 | Link |
| (3R)-hydroxymyristoyl-[acyl carrier protein] dehydratase; (3R)-hydroxymyristoyl ACP dehydrase [-] | SEA | E_value = 3.34e-20 & MaxTC = 0.5 | Link |
| GABA receptor alpha-1 subunit | SEA | E_value = 2.04e-18 & MaxTC = 0.48 | Link |
| Aldose reductase | SEA | E_value = 2.88e-17 & MaxTC = 0.43 | Link |
| enoyl-[acyl-carrier-protein] reductase [NADH] [-] | SEA | E_value = 5.09e-12 & MaxTC = 0.5 | Link |
| P-glycoprotein 1; multi-drug resistance protein 1 | SEA | E_value = 1.2e-11 & MaxTC = 0.44 | Link |
| GABA receptor alpha-6 subunit | SEA | E_value = 1.21e-11 & MaxTC = 0.42 | Link |
| Estradiol 17-beta-dehydrogenase 3 | SEA | E_value = 5.21e-11 & MaxTC = 0.42 | Link |
| serum albumin [-] | SEA | E_value = 7.32e-11 & MaxTC = 0.5 | Link |
Data not available
| Chemical Name | Confidence score | Molecular Weight |
|---|---|---|
| dTDP-L-rhamnosePubChem | 0.995 | 548.33 |
| NADP(H)PubChem | 0.974 | 745.421 |
| NADPPubChem | 0.937 | 744.413 |
| TDP-4-keto-6-deoxy-d-glucosePubChem | 0.9 | 546.314 |
| deuteriumPubChem | 0.9 | 2.01588 |
| protiumPubChem | 0.9 | 2.01576 |
| H(+)PubChem | 0.9 | 2.01588 |
| dTDP-4-keto-L-rhamnosePubChem | 0.9 | 546.314 |
| dTDP-4-dehydro-L-rhamnosePubChem | 0.9 | 544.298 |
| glucose-1-phosphatePubChem | 0.791 | 260.136 |
| N-butyryl-L-homoserine lactonePubChem | 0.767 | 171.194 |
| butyryl coenzyme APubChem | 0.765 | 837.624 |
| rhamnosePubChem | 0.741 | 164.156 |
| deoxythymidine diphosphate-glucosePubChem | 0.732 | 564.329 |
| dTDP-glucosePubChem | 0.725 | 564.329 |
| fucosePubChem | 0.72 | 164.156 |
| butyryl-CoAPubChem | 0.703 | 837.624 |
| rhodaninePubChem | 0.702 | 133.192 |
