SInCRe - Rv2165c

Tuberculist information

Gene name	Rv2165c
Protein function	Conserved protein
Functional category(tuberculist)	conserved hypotheticals
Gene location(kb)	2428.24
Molecular mass(da)	42497.2
External sites	TB Database TubercuList WebTB

Protein sequence

Number of amino acids : 396

	  		  	1    VQTRAPWSLPEATLAYFPNARFVSSDRDLGAGAAPGIAASRSTACQTWGGITVADPGSGP   60
			  	61   TGFGHVPVLAQRCFELLTPALTRYYPDGSQAVLLDATIGAGGHAERFLEGLPGLRLIGLD  120
			  	121  RDPTALDVARSRLVRFADRLTLVHTRYDCLGAALAESGYAAVGSVDGILFDLGVSSMQLD  180
			  	181  RAERGFAYATDAPLDMRMDPTTPLTAADIVNTYDEAALADILRRYGEERFARRIAAGIVR  240
			  	241  RRAKTPFTSTAELVALLYQAIPAPARRVGGHPAKRTFQALRIAVNDELESLRTAVPAALD  300
			  	301  ALAIGGRIAVLAYQSLEDRIVKRVFAEAVASATPAGLPVELPGHEPRFRSLTHGAERASV  360
			  	361  AEIERNPRSTPVRLRALQRVEHRAQSQQWATEKGDS

Known structures in the PDB

No Known structures

Number of amino acids : 396

Domains assigned based on sequence.

Mtb Structural proteome models

CHOPIN models

Profile-based domain assignment

Structural/Functional domain family	Pfam acc.no./SCOP ID	Domain Region
Methyltransf_5	PF01795	62-380

Mtb Structural Proteome models

Model Number	1
Model name	Rv2165c
Template	1WG8 APDB CREDO
Template coverage	6_282
Template Identity(%)	46.6
Model coverage(%)	79.3
Normalized DOPE score	-0.378

Model Number	2
Model name	Rv2165c.1
Template	1SQG APDB CREDO
Template coverage	162_385
Template Identity(%)	16.5
Model coverage(%)	54.8
Normalized DOPE score	0.45

Structure Models from Chopin

Model Number	1
Profile	a.60.13.1 Click for model details
zscore	19.2
Residue begin	183
Residue end	285

Binding pockets

STRING

Cytoscape Web will replace the contents of this div with protein-protein interaction network.

Protein interacting with Rv2165c	Gene name	Confidence Score
Rv2166c	Rv2166c	0.999
Rv2163c	pbpB	0.994
Rv2163c	pbpB	0.994
Rv2150c	ftsZ	0.989
Rv2150c	ftsZ	0.989
Rv2158c	murE	0.984
Rv2158c	murE	0.984
Rv2158c	murE	0.984
Rv0017c	rodA	0.981
Rv2154c	ftsW	0.98
Rv2155c	murD	0.971
Rv2155c	murD	0.971
Rv0482	murB	0.961
Rv0482	murB	0.961
Rv2981c	ddlA	0.959
Rv2981c	ddlA	0.959
Rv2164c	Rv2164c	0.951
Rv2156c	murX	0.93
Rv2156c	murX	0.93
Rv2153c	murG	0.913
Rv2153c	murG	0.913
Rv1536	ileS	0.909
Rv1536	ileS	0.909

Potential ligand/drug binding sites

Protein Model	Pocket Number	Drug Binding Site	PMIN Score	Pvalue PMIN	PMAX Score	Pvalue PMAX
Rv2165c.1	1	3pww_ROC_A_1001 PDB CREDO	0.591	0.190	0.591	0.002
Rv2165c.1	1	1uwj_BAX_A_1723 PDB CREDO	0.676	0.100	0.590	0.003
Rv2165c.1	1	1t46_STI_A_3 PDB CREDO	0.585	0.198	0.585	0.003
Rv2165c.1	1	2v0z_C41_O_1327 PDB CREDO	0.592	0.189	0.576	0.003
Rv2165c.1	1	2v0z_C41_C_1328 PDB CREDO	0.614	0.163	0.553	0.005
Rv2165c.1	1	3d91_REM_B_350 PDB CREDO	0.690	0.089	0.552	0.005
Rv2165c.1	1	3nxu_RIT_A_600 PDB CREDO	0.581	0.202	0.551	0.005
Rv2165c.1	1	3cs9_NIL_D_600 PDB CREDO	0.550	0.244	0.550	0.005
Rv2165c.1	1	3d91_REM_A_350 PDB CREDO	0.687	0.091	0.549	0.005
Rv2165c.1	1	3cs9_NIL_C_600 PDB CREDO	0.549	0.246	0.549	0.005
Rv2165c.1	1	3nxu_RIT_B_600 PDB CREDO	0.579	0.205	0.548	0.005
Rv2165c.1	1	1uwj_BAX_B_1723 PDB CREDO	0.683	0.094	0.546	0.005
Rv2165c.1	1	1xkk_FMM_A_91 PDB CREDO	0.575	0.211	0.545	0.005
Rv2165c.1	1	3bjw_SVR_E_503 PDB CREDO	0.553	0.240	0.539	0.006
Rv2165c.1	1	3prs_RIT_A_1001 PDB CREDO	0.626	0.149	0.537	0.006
Rv2165c.1	1	2vn1_FK5_A_501 PDB CREDO	0.580	0.203	0.535	0.006
Rv2165c.1	1	1opj_STI_A_3 PDB CREDO	0.580	0.204	0.534	0.006
Rv2165c.1	1	1opj_STI_B_4 PDB CREDO	0.578	0.207	0.533	0.007
Rv2165c.1	1	1tco_FK5_C_509 PDB CREDO	0.575	0.210	0.532	0.007
Rv2165c.1	1	1uwh_BAX_A_1723 PDB CREDO	0.703	0.078	0.529	0.007
Rv2165c.1	1	1uwh_BAX_B_1723 PDB CREDO	0.702	0.079	0.528	0.007
Rv2165c.1	1	3bjw_SVR_F_502 PDB CREDO	0.556	0.236	0.527	0.007
Rv2165c.1	1	3bjw_SVR_B_501 PDB CREDO	0.555	0.236	0.527	0.007
Rv2165c.1	1	3k5v_STI_A_2 PDB CREDO	0.587	0.195	0.527	0.007
Rv2165c.1	1	3bjw_SVR_H_504 PDB CREDO	0.553	0.239	0.525	0.007
Rv2165c.1	1	2hyy_STI_A_600 PDB CREDO	0.618	0.158	0.524	0.008
Rv2165c.1	1	3k5v_STI_B_2 PDB CREDO	0.618	0.158	0.524	0.008
Rv2165c.1	1	3cs9_NIL_B_600 PDB CREDO	0.551	0.242	0.522	0.008
Rv2165c.1	1	3mss_STI_A_1 PDB CREDO	0.616	0.161	0.522	0.008
Rv2165c.1	1	1iep_STI_A_201 PDB CREDO	0.615	0.162	0.521	0.008
Rv2165c.1	1	2hyy_STI_C_600 PDB CREDO	0.615	0.162	0.521	0.008
Rv2165c.1	1	3b0w_DGX_B_1 PDB CREDO	0.581	0.203	0.521	0.008
Rv2165c.1	1	3mss_STI_B_1 PDB CREDO	0.614	0.162	0.521	0.008
Rv2165c.1	1	3mss_STI_D_1 PDB CREDO	0.614	0.162	0.521	0.008
Rv2165c.1	1	3ms9_STI_A_1 PDB CREDO	0.614	0.163	0.520	0.008
Rv2165c.1	1	2hyy_STI_D_600 PDB CREDO	0.614	0.163	0.520	0.008
Rv2165c.1	1	3pyy_STI_A_3 PDB CREDO	0.614	0.163	0.520	0.008
Rv2165c.1	1	3kk6_CEL_A_701 PDB CREDO	0.547	0.248	0.519	0.008
Rv2165c.1	1	3gvu_STI_A_1001 PDB CREDO	0.613	0.164	0.519	0.008
Rv2165c.1	1	3cs9_NIL_A_600 PDB CREDO	0.562	0.227	0.519	0.008
Rv2165c.1	1	3pyy_STI_B_4 PDB CREDO	0.612	0.165	0.519	0.008
Rv2165c.1	1	3mss_STI_C_1 PDB CREDO	0.612	0.165	0.518	0.008
Rv2165c.1	1	1iep_STI_B_202 PDB CREDO	0.611	0.166	0.518	0.008
Rv2165c.1	1	3kk6_CEL_B_1701 PDB CREDO	0.546	0.250	0.517	0.008
Rv2165c.1	1	3ms9_STI_B_1 PDB CREDO	0.610	0.167	0.517	0.008
Rv2165c.1	1	3sm2_478_A_126 PDB CREDO	0.573	0.212	0.517	0.008
Rv2165c.1	1	1z2b_VLB_C_800 PDB CREDO	0.659	0.115	0.512	0.009
Rv2165c.1	1	2qxs_RAL_B_600 PDB CREDO	0.540	0.258	0.512	0.009
Rv2165c.1	1	2qxs_RAL_A_600 PDB CREDO	0.537	0.263	0.509	0.010
Rv2165c.1	1	1skx_RFP_A_1 PDB CREDO	0.535	0.266	0.507	0.010
Rv2165c.1	1	1fap_RAP_A_108 PDB CREDO	0.520	0.288	0.506	0.010
Rv2165c.1	1	2xkw_P1B_A_1478 PDB CREDO	0.547	0.249	0.506	0.010
Rv2165c.1	1	3tne_RIT_B_401 PDB CREDO	0.711	0.073	0.503	0.010
Rv2165c.1	1	4asd_BAX_A_1500 PDB CREDO	0.629	0.146	0.503	0.010
Rv2165c.1	1	3tne_RIT_A_401 PDB CREDO	0.707	0.075	0.500	0.011

Similarity to known drug target from sensitive sequence analysis

No drug targets

List of small molecules tested from TIBLE

Data not available

Off-target activity - ligand based from TIBLE

Data not available

Small molecules involved in protein-protein complex from TIMBAL .Proteins similar to Mtb based on sequence analysis.

Data not available

STITCH interactions

Chemical Name	Confidence score	Molecular Weight
S-adenosyl-L-methioninePubChem	0.854	399.445
S-adenosylhomocysteinePubChem	0.852	384.411