SInCRe - Rv1213

Tuberculist information

Gene name	glgC
Protein function	Glucose-1-phosphate adenylyltransferase GlgC (ADP-glucose synthase) (ADP-glucose pyrophosphorylase)
Functional category(tuberculist)	intermediary metabolism and respiration
Gene location(kb)	1355.84
Molecular mass(da)	43800.4
External sites	TB Database TubercuList WebTB

Protein sequence

Number of amino acids : 404

	  		  	1    MREVPHVLGIVLAGGEGKRLYPLTADRAKPAVPFGGAYRLIDFVLSNLVNARYLRICVLT   60
			  	61   QYKSHSLDRHISQNWRLSGLAGEYITPVPAQQRLGPRWYTGSADAIYQSLNLIYDEDPDY  120
			  	121  IVVFGADHVYRMDPEQMVRFHIDSGAGATVAGIRVPRENATAFGCIDADDSGRIRSFVEK  180
			  	181  PLEPPGTPDDPDTTFVSMGNYIFTTKVLIDAIRADADDDHSDHDMGGDIVPRLVADGMAA  240
			  	241  VYDFSDNEVPGATDRDRAYWRDVGTLDAFYDAHMDLVSVHPVFNLYNKRWPIRGESENLA  300
			  	301  PAKFVNGGSAQESVVGAGSIISAASVRNSVLSSNVVVDDGAIVEGSVIMPGTRVGRGAVV  360
			  	361  RHAILDKNVVVGPGEMVGVDLEKDRERFAISAGGVVAVGKGVWI

Known structures in the PDB

No Known structures

Number of amino acids : 404

Domains assigned based on sequence.

Mtb Structural proteome models

CHOPIN models

Profile-based domain assignment

Structural/Functional domain family	Pfam acc.no./SCOP ID	Domain Region
NTP_transferase	PF00483	8-279
Hexapep	PF00132	328-362

Mtb Structural Proteome models

Model Number	1
Model name	Rv1213
Template	1YP2 APDB CREDO
Template coverage	21_409
Template Identity(%)	35.8
Model coverage(%)	90.3
Normalized DOPE score	-0.587

Model Number	2
Model name	Rv1213.1
Template	1YP2 APDB CREDO
Template coverage	10_445
Template Identity(%)	27.0
Model coverage(%)	99.5
Normalized DOPE score	0.275

Structure Models from Chopin

Model Number	1
Profile	b.81.1.4, c.68.1.6 Click for model details
zscore	61.36
Residue begin	2
Residue end	404

Model Number	2
Profile	c.68.1.6 Click for model details
zscore	50.39
Residue begin	2
Residue end	297

Model Number	3
Profile	b.81.1.4 Click for model details
zscore	12.94
Residue begin	299
Residue end	404

Binding pockets

STRING

Cytoscape Web will replace the contents of this div with protein-protein interaction network.

Protein interacting with Rv1213	Gene name	Confidence Score
Rv1326c	glgB	0.999
Rv1326c	glgB	0.999
Rv1326c	glgB	0.999
Rv1564c	treX	0.997
Rv1328	glgP	0.997
Rv1328	glgP	0.997
Rv1564c	treX	0.997
Rv3068c	pgmA	0.982
Rv3068c	pgmA	0.982
Rv3068c	pgmA	0.982
Rv3068c	pgmA	0.982
Rv3257c	pmmA	0.967
Rv3257c	pmmA	0.967
Rv3257c	pmmA	0.967
Rv3257c	pmmA	0.967
Rv1562c	treZ	0.958
Rv1562c	treZ	0.958
Rv0993	galU	0.948
Rv0946c	pgi	0.941
Rv1212c	glgA	0.926
Rv1212c	glgA	0.926

Potential ligand/drug binding sites

Protein Model	Pocket Number	Drug Binding Site	PMIN Score	Pvalue PMIN	PMAX Score	Pvalue PMAX
Rv1213.1	3	1lhv_NOG_A_301 PDB CREDO	0.634	0.140	0.634	0.001
Rv1213.1	3	3tne_RIT_A_401 PDB CREDO	0.609	0.168	0.590	0.003
Rv1213.1	3	3tkd_CYZ_B_267 PDB CREDO	0.642	0.133	0.584	0.003
Rv1213.1	5	3kp6_SAL_A_3002 PDB CREDO	0.584	0.199	0.584	0.003
Rv1213.1	3	3tkd_CYZ_A_266 PDB CREDO	0.601	0.178	0.582	0.003
Rv1213.1	3	2aa5_STR_A_301 PDB CREDO	0.620	0.156	0.581	0.003
Rv1213.1	3	2aa5_STR_B_302 PDB CREDO	0.619	0.157	0.580	0.003
Rv1213.1	3	2ab2_SNL_A_502 PDB CREDO	0.598	0.182	0.579	0.003
Rv1213.1	3	2ab2_SNL_B_503 PDB CREDO	0.597	0.183	0.578	0.003
Rv1213.1	3	2oax_SNL_C_3001 PDB CREDO	0.597	0.183	0.578	0.003
Rv1213.1	3	1uwh_BAX_A_1723 PDB CREDO	0.632	0.142	0.576	0.003
Rv1213.1	3	1uwh_BAX_B_1723 PDB CREDO	0.632	0.142	0.576	0.003
Rv1213.1	3	3vhu_SNL_A_1001 PDB CREDO	0.593	0.187	0.575	0.003
Rv1213.1	3	2oax_SNL_B_2001 PDB CREDO	0.591	0.190	0.572	0.003
Rv1213.1	3	1jg2_ADN_A_500 PDB CREDO	0.673	0.103	0.569	0.004
Rv1213.1	3	2aa6_STR_A_401 PDB CREDO	0.605	0.172	0.567	0.004
Rv1213.1	3	2aax_PDN_A_502 PDB CREDO	0.605	0.173	0.567	0.004
Rv1213.1	3	2aa6_STR_B_402 PDB CREDO	0.603	0.175	0.565	0.004
Rv1213.1	3	2aax_PDN_B_503 PDB CREDO	0.601	0.178	0.563	0.004
Rv1213.1	3	3ut5_LOC_D_502 PDB CREDO	0.580	0.204	0.562	0.004
Rv1213.1	3	3d91_REM_B_350 PDB CREDO	0.655	0.120	0.561	0.004
Rv1213.1	3	2y6o_1N1_A_1892 PDB CREDO	0.560	0.231	0.560	0.004
Rv1213.1	3	3rif_IVM_A_402 PDB CREDO	0.706	0.076	0.557	0.004
Rv1213.1	3	2nni_MTK_A_501 PDB CREDO	0.668	0.107	0.556	0.005
Rv1213.1	3	3bbt_FMM_D_91 PDB CREDO	0.635	0.140	0.556	0.005
Rv1213.1	3	3mne_DEX_A_784 PDB CREDO	0.574	0.212	0.556	0.005
Rv1213.1	3	3d91_REM_A_350 PDB CREDO	0.648	0.127	0.555	0.005
Rv1213.1	3	1z2b_VLB_C_800 PDB CREDO	0.628	0.147	0.555	0.005
Rv1213.1	3	3rif_IVM_B_403 PDB CREDO	0.703	0.078	0.555	0.005
Rv1213.1	3	3rif_IVM_D_402 PDB CREDO	0.703	0.078	0.555	0.005
Rv1213.1	3	1p93_DEX_C_3999 PDB CREDO	0.572	0.214	0.554	0.005
Rv1213.1	3	3ria_IVM_C_349 PDB CREDO	0.701	0.080	0.552	0.005
Rv1213.1	3	3ri5_IVM_C_350 PDB CREDO	0.699	0.081	0.551	0.005
Rv1213.1	8	3nxu_RIT_A_600 PDB CREDO	0.566	0.222	0.551	0.005
Rv1213.1	3	1m2z_DEX_A_301 PDB CREDO	0.569	0.218	0.551	0.005
Rv1213.1	3	3gn8_DEX_A_247 PDB CREDO	0.569	0.218	0.551	0.005
Rv1213.1	3	3gn8_DEX_B_247 PDB CREDO	0.568	0.219	0.550	0.005
Rv1213.1	3	1lhu_EST_A_301 PDB CREDO	0.672	0.104	0.549	0.005
Rv1213.1	3	1m2z_DEX_D_401 PDB CREDO	0.567	0.221	0.549	0.005
Rv1213.1	3	1p93_DEX_D_4999 PDB CREDO	0.567	0.221	0.549	0.005
Rv1213.1	3	3mno_DEX_A_784 PDB CREDO	0.584	0.198	0.549	0.005
Rv1213.1	3	3tne_RIT_B_401 PDB CREDO	0.565	0.223	0.548	0.005
Rv1213.1	3	3mnp_DEX_A_784 PDB CREDO	0.583	0.200	0.548	0.005
Rv1213.1	5	1lin_TFP_A_156 PDB CREDO	0.547	0.248	0.547	0.005
Rv1213.1	5	2xf3_J01_A_500 PDB CREDO	0.547	0.248	0.547	0.005
Rv1213.1	3	3ut5_LOC_B_502 PDB CREDO	0.600	0.179	0.546	0.005
Rv1213.1	3	1ya3_STR_B_2001 PDB CREDO	0.645	0.130	0.546	0.005
Rv1213.1	3	1sa1_POD_D_701 PDB CREDO	0.618	0.159	0.545	0.005
Rv1213.1	3	3q70_RIT_A_2001 PDB CREDO	0.617	0.159	0.545	0.005
Rv1213.1	3	1ya3_STR_A_1001 PDB CREDO	0.642	0.133	0.543	0.006
Rv1213.1	3	3rif_IVM_A_403 PDB CREDO	0.689	0.089	0.543	0.006
Rv1213.1	3	1uwj_BAX_B_1723 PDB CREDO	0.633	0.142	0.543	0.006
Rv1213.1	5	1ya4_CTX_A_11 PDB CREDO	0.582	0.201	0.542	0.006
Rv1213.1	8	3nxu_RIT_B_600 PDB CREDO	0.556	0.235	0.542	0.006
Rv1213.1	3	3frq_ERY_B_195 PDB CREDO	0.559	0.232	0.541	0.006
Rv1213.1	3	2oax_SNL_D_4001 PDB CREDO	0.612	0.164	0.541	0.006
Rv1213.1	3	2oax_SNL_E_5001 PDB CREDO	0.611	0.166	0.540	0.006
Rv1213.1	3	1a28_STR_B_2 PDB CREDO	0.539	0.259	0.539	0.006
Rv1213.1	3	1nhz_486_A_800 PDB CREDO	0.595	0.185	0.539	0.006
Rv1213.1	3	1p93_DEX_B_2999 PDB CREDO	0.615	0.161	0.539	0.006
Rv1213.1	3	2oax_SNL_A_1001 PDB CREDO	0.610	0.167	0.539	0.006
Rv1213.1	3	2oax_SNL_F_6001 PDB CREDO	0.610	0.167	0.539	0.006
Rv1213.1	3	1sa1_POD_B_700 PDB CREDO	0.627	0.148	0.537	0.006
Rv1213.1	26	1kij_NOV_A_400 PDB CREDO	0.632	0.143	0.536	0.006
Rv1213.1	3	3h52_486_D_2 PDB CREDO	0.586	0.196	0.533	0.007
Rv1213.1	5	1muo_ADN_A_1 PDB CREDO	0.571	0.215	0.533	0.007
Rv1213.1	3	3rif_IVM_E_402 PDB CREDO	0.755	0.045	0.533	0.007
Rv1213.1	3	1jg3_ADN_A_500 PDB CREDO	0.700	0.081	0.532	0.007
Rv1213.1	3	1p93_DEX_A_1999 PDB CREDO	0.606	0.172	0.531	0.007
Rv1213.1	3	1uwj_BAX_A_1723 PDB CREDO	0.674	0.102	0.530	0.007
Rv1213.1	3	3k54_1N1_A_1 PDB CREDO	0.697	0.083	0.530	0.007
Rv1213.1	8	1uwj_BAX_A_1723 PDB CREDO	0.591	0.190	0.529	0.007
Rv1213.1	8	2vn1_FK5_A_501 PDB CREDO	0.558	0.233	0.528	0.007
Rv1213.1	5	1q97_ADN_B_486 PDB CREDO	0.566	0.222	0.527	0.007
Rv1213.1	3	3rhw_IVM_B_349 PDB CREDO	0.747	0.050	0.527	0.007
Rv1213.1	3	3ri5_IVM_B_349 PDB CREDO	0.746	0.050	0.526	0.007
Rv1213.1	3	3ria_IVM_A_348 PDB CREDO	0.746	0.050	0.526	0.007
Rv1213.1	3	3rhw_IVM_D_348 PDB CREDO	0.745	0.050	0.526	0.007
Rv1213.1	26	3v5w_8PR_A_701 PDB CREDO	0.561	0.229	0.526	0.007
Rv1213.1	3	3rhw_IVM_B_348 PDB CREDO	0.745	0.051	0.525	0.007
Rv1213.1	3	3ri5_IVM_D_349 PDB CREDO	0.745	0.051	0.525	0.007
Rv1213.1	26	2gqg_1N1_B_502 PDB CREDO	0.579	0.205	0.525	0.007
Rv1213.1	5	3p4w_DSF_A_319 PDB CREDO	0.525	0.281	0.525	0.007
Rv1213.1	3	3oct_1N1_A_663 PDB CREDO	0.619	0.156	0.524	0.008
Rv1213.1	3	3ria_IVM_C_350 PDB CREDO	0.743	0.052	0.524	0.008
Rv1213.1	3	2h42_VIA_A_901 PDB CREDO	0.598	0.182	0.524	0.008
Rv1213.1	3	3rhw_IVM_D_349 PDB CREDO	0.742	0.052	0.523	0.008
Rv1213.1	3	3h52_486_B_1 PDB CREDO	0.592	0.188	0.523	0.008
Rv1213.1	26	3oez_STI_B_601 PDB CREDO	0.522	0.284	0.522	0.008
Rv1213.1	3	3ria_IVM_E_348 PDB CREDO	0.740	0.053	0.522	0.008
Rv1213.1	3	2x9g_LYA_A_1270 PDB CREDO	0.522	0.285	0.522	0.008
Rv1213.1	3	3ri5_IVM_A_349 PDB CREDO	0.739	0.054	0.522	0.008
Rv1213.1	3	3jwq_VIA_D_901 PDB CREDO	0.595	0.185	0.521	0.008
Rv1213.1	4	3ur0_SVR_C_517 PDB CREDO	0.541	0.256	0.521	0.008
Rv1213.1	3	3e22_LOC_B_700 PDB CREDO	0.537	0.262	0.520	0.008
Rv1213.1	26	2jfa_RAL_A_600 PDB CREDO	0.520	0.287	0.520	0.008
Rv1213.1	3	2fum_MIX_D_3539 PDB CREDO	0.594	0.186	0.520	0.008
Rv1213.1	3	3rhw_IVM_A_348 PDB CREDO	0.737	0.056	0.520	0.008
Rv1213.1	5	3bgd_PM6_B_301 PDB CREDO	0.520	0.288	0.520	0.008
Rv1213.1	5	3p4w_DSF_C_320 PDB CREDO	0.520	0.288	0.520	0.008
Rv1213.1	26	2hyy_STI_B_600 PDB CREDO	0.569	0.217	0.519	0.008
Rv1213.1	3	3ria_IVM_E_349 PDB CREDO	0.736	0.056	0.519	0.008
Rv1213.1	3	2ito_IRE_A_2020 PDB CREDO	0.735	0.057	0.519	0.008
Rv1213.1	3	3e22_LOC_D_700 PDB CREDO	0.535	0.266	0.518	0.008
Rv1213.1	3	2gqg_1N1_B_502 PDB CREDO	0.552	0.241	0.518	0.008
Rv1213.1	8	3bjw_SVR_C_505 PDB CREDO	0.517	0.292	0.517	0.008
Rv1213.1	3	3spk_TPV_A_100 PDB CREDO	0.570	0.217	0.517	0.008
Rv1213.1	26	1uwh_BAX_A_1723 PDB CREDO	0.550	0.245	0.517	0.008
Rv1213.1	26	1uwh_BAX_B_1723 PDB CREDO	0.550	0.245	0.517	0.008
Rv1213.1	26	1qkn_RAL_A_600 PDB CREDO	0.549	0.245	0.515	0.009
Rv1213.1	8	3bjw_SVR_G_506 PDB CREDO	0.529	0.274	0.515	0.009
Rv1213.1	3	3so9_017_A_100 PDB CREDO	0.564	0.224	0.514	0.009
Rv1213.1	3	2q1v_PDN_A_248 PDB CREDO	0.607	0.171	0.514	0.009
Rv1213.1	4	3lxe_TOR_B_262 PDB CREDO	0.533	0.268	0.513	0.009
Rv1213.1	26	3tne_RIT_B_401 PDB CREDO	0.511	0.301	0.511	0.009
Rv1213.1	8	3bjw_SVR_E_503 PDB CREDO	0.511	0.301	0.511	0.009
Rv1213.1	8	1fap_RAP_A_108 PDB CREDO	0.511	0.302	0.511	0.009
Rv1213.1	3	3d90_NOG_A_1001 PDB CREDO	0.563	0.226	0.510	0.009
Rv1213.1	4	3lxe_TOR_A_262 PDB CREDO	0.530	0.272	0.510	0.009
Rv1213.1	3	1ya3_STR_C_3001 PDB CREDO	0.671	0.105	0.510	0.009
Rv1213.1	5	3kp6_SAL_B_3003 PDB CREDO	0.637	0.138	0.510	0.009
Rv1213.1	26	2fum_MIX_D_3539 PDB CREDO	0.600	0.179	0.509	0.010
Rv1213.1	26	3tne_RIT_A_401 PDB CREDO	0.508	0.306	0.508	0.010
Rv1213.1	26	2pl0_STI_A_200 PDB CREDO	0.557	0.234	0.508	0.010
Rv1213.1	3	3h52_486_A_3 PDB CREDO	0.558	0.233	0.508	0.010
Rv1213.1	26	3ms9_STI_B_1 PDB CREDO	0.608	0.169	0.508	0.010
Rv1213.1	26	1uwj_BAX_B_1723 PDB CREDO	0.573	0.213	0.507	0.010
Rv1213.1	3	3d90_NOG_B_2001 PDB CREDO	0.558	0.233	0.506	0.010
Rv1213.1	3	2fum_MIX_A_539 PDB CREDO	0.641	0.134	0.505	0.010
Rv1213.1	26	3pyy_STI_A_3 PDB CREDO	0.605	0.173	0.505	0.010
Rv1213.1	26	3pyy_STI_B_4 PDB CREDO	0.604	0.174	0.504	0.010
Rv1213.1	26	2hyy_STI_C_600 PDB CREDO	0.604	0.175	0.504	0.010
Rv1213.1	26	1iep_STI_A_201 PDB CREDO	0.603	0.175	0.504	0.010
Rv1213.1	26	1iep_STI_B_202 PDB CREDO	0.603	0.175	0.504	0.010
Rv1213.1	26	4asd_BAX_A_1500 PDB CREDO	0.569	0.218	0.504	0.010
Rv1213.1	26	3gvu_STI_A_1001 PDB CREDO	0.603	0.176	0.503	0.010
Rv1213.1	3	2w8y_486_A_1000 PDB CREDO	0.587	0.195	0.503	0.010
Rv1213.1	3	1mx1_THA_C_3 PDB CREDO	0.615	0.161	0.503	0.010
Rv1213.1	26	2y6o_1N1_A_1892 PDB CREDO	0.519	0.290	0.502	0.011
Rv1213.1	3	1fm6_BRL_X_504 PDB CREDO	0.502	0.315	0.502	0.011
Rv1213.1	26	3mss_STI_A_1 PDB CREDO	0.601	0.178	0.502	0.011
Rv1213.1	26	3mss_STI_C_1 PDB CREDO	0.601	0.178	0.502	0.011
Rv1213.1	3	3ri5_IVM_E_349 PDB CREDO	0.769	0.038	0.502	0.011
Rv1213.1	8	3bjw_SVR_H_504 PDB CREDO	0.543	0.254	0.501	0.011
Rv1213.1	26	2hyy_STI_A_600 PDB CREDO	0.600	0.179	0.501	0.011
Rv1213.1	26	3ms9_STI_A_1 PDB CREDO	0.600	0.179	0.501	0.011
Rv1213.1	26	3mss_STI_B_1 PDB CREDO	0.600	0.179	0.501	0.011
Rv1213.1	26	3k5v_STI_B_2 PDB CREDO	0.600	0.179	0.501	0.011
Rv1213.1	26	3mss_STI_D_1 PDB CREDO	0.600	0.179	0.501	0.011
Rv1213.1	26	2hyy_STI_D_600 PDB CREDO	0.599	0.180	0.500	0.011

Similarity to known drug target from sensitive sequence analysis

No drug targets

List of small molecules tested from TIBLE

Data not available

Off-target activity - ligand based from TIBLE

Data not available

Small molecules involved in protein-protein complex from TIMBAL .Proteins similar to Mtb based on sequence analysis.

Data not available

STITCH interactions

Chemical Name	Confidence score	Molecular Weight
ADP-glucosePubChem	0.978	589.342
glucose-1-phosphatePubChem	0.978	260.136
pyrophosphatePubChem	0.943	177.975
adenosine diphosphatePubChem	0.943	427.201
adenosine triphosphatePubChem	0.924	507.181
ADP-D-GLUCOSEPubChem	0.9	589.342
glycogenPubChem	0.833	666.578
ADP-GlcPubChem	0.758	633.305
fructose 1,6-bisphosphatePubChem	0.756	340.116
fructose 6-phosphatePubChem	0.754	260.136
alpha-glucanPubChem	0.752	504.437
3-phosphoglyceratePubChem	0.723	186.057
pyridoxal phosphatePubChem	0.716	247.142
phenylglyoxalPubChem	0.713	134.132
sulfatePubChem	0.709	96.0626