SInCRe - Rv3721c

Tuberculist information

Gene name	dnaZX
Protein function	DNA polymerase III (subunit gamma/tau) DnaZ/X
Functional category(tuberculist)	information pathways
Gene location(kb)	4165
Molecular mass(da)	61891.3
External sites	TB Database TubercuList WebTB

Protein sequence

Number of amino acids : 578

	  		  	1    VALYRKYRPASFAEVVGQEHVTAPLSVALDAGRINHAYLFSGPRGCGKTSSARILARSLN   60
			  	61   CAQGPTANPCGVCESCVSLAPNAPGSIDVVELDAASHGGVDDTRELRDRAFYAPVQSRYR  120
			  	121  VFIVDEAHMVTTAGFNALLKIVEEPPEHLIFIFATTEPEKVLPTIRSRTHHYPFRLLPPR  180
			  	181  TMRALLARICEQEGVVVDDAVYPLVIRAGGGSPRDTLSVLDQLLAGAADTHVTYTRALGL  240
			  	241  LGVTDVALIDDAVDALAACDAAALFGAIESVIDGGHDPRRFATDLLERFRDLIVLQSVPD  300
			  	301  AASRGVVDAPEDALDRMREQAARIGRATLTRYAEVVQAGLGEMRGATAPRLLLEVVCARL  360
			  	361  LLPSASDAESALLQRVERIETRLDMSIPAPQAVPRPSAAAAEPKHQPAREPRPVLAPTPA  420
			  	421  SSEPTVAAVRSMWPTVRDKVRLRSRTTEVMLAGATVRALEDNTLVLTHESAPLARRLSEQ  480
			  	481  RNADVLAEALKDALGVNWRVRCETGEPAAAASPVGGGANVATAKAVNPAPTANSTQRDEE  540
			  	541  EHMLAEAGRGDPSPRRDPEEVALELLQNELGARRIDNA

Known structures in the PDB

No Known structures

Number of amino acids : 578

Domains assigned based on sequence.

Mtb Structural proteome models

CHOPIN models

Profile-based domain assignment

Structural/Functional domain family	Pfam acc.no./SCOP ID	Domain Region
DNA_pol3_delta2	PF13177	17-178
DNA_pol3_gamma3	PF12169	232-375

Mtb Structural Proteome models

Model Number	1
Model name	Rv3721c
Template	1JR3 APDB CREDO
Template coverage	5_362
Template Identity(%)	37.7
Model coverage(%)	63.0
Normalized DOPE score	-0.37

Model Number	2
Model name	Rv3721c.2
Template	1QVR APDB CREDO
Template coverage	160_573
Template Identity(%)	15.9
Model coverage(%)	68.7
Normalized DOPE score	1.197

Structure Models from Chopin

Model Number	1
Profile	1.10.8.10, 1.20.272.10, 3.40.50.300 Click for model details
zscore	26.96
Residue begin	12
Residue end	351

Model Number	2
Profile	a.80.1.1, c.37.1.20 - 1.10.8.60, 1.20.272.10, 3.40.50.300 Click for model details
zscore	22.99
Residue begin	1
Residue end	554

Model Number	3
Profile	c.37.1.20 Click for model details
zscore	21.41
Residue begin	17
Residue end	178

Model Number	4
Profile	c.37.1.2 - 3.40.50.300 Click for model details
zscore	9.08
Residue begin	32
Residue end	237

Model Number	5
Profile	a.80.1.1 Click for model details
zscore	5.53
Residue begin	242
Residue end	375

Binding pockets

STRING

Cytoscape Web will replace the contents of this div with protein-protein interaction network.

Protein interacting with Rv3721c	Gene name	Confidence Score
Rv2445c	ndkA	0.986
Rv0002	dnaN	0.978
Rv0002	dnaN	0.978
Rv0002	dnaN	0.978
Rv3715c	recR	0.973
Rv3715c	recR	0.973
Rv3715c	recR	0.973
Rv1547	dnaE1	0.967
Rv1547	dnaE1	0.967
Rv1547	dnaE1	0.967
Rv1547	dnaE1	0.967
Rv1617	pykA	0.964
Rv0058	dnaB	0.964
Rv0058	dnaB	0.964
Rv0058	dnaB	0.964
Rv0058	dnaB	0.964
Rv1617	pykA	0.964
Rv3370c	dnaE2	0.962
Rv3370c	dnaE2	0.962
Rv3370c	dnaE2	0.962
Rv3370c	dnaE2	0.962
Rv1007c	metS	0.944
Rv0005	gyrB	0.928
Rv0005	gyrB	0.928
Rv0005	gyrB	0.928
Rv0005	gyrB	0.928
Rv2839c	infB	0.922
Rv2839c	infB	0.922
Rv2839c	infB	0.922
Rv2839c	infB	0.922
Rv1021	Rv1021	0.921
Rv2344c	dgt	0.917
Rv2344c	dgt	0.917
Rv1649	pheS	0.903
Rv1649	pheS	0.903
Rv3716c	Rv3716c	0.902
Rv2614c	thrS	0.901
Rv2614c	thrS	0.901
Rv2614c	thrS	0.901

Potential ligand/drug binding sites

Protein Model	Pocket Number	Drug Binding Site	PMIN Score	Pvalue PMIN	PMAX Score	Pvalue PMAX
Rv3721c.2	4	1lhv_NOG_A_301 PDB CREDO	0.622	0.154	0.622	0.001
Rv3721c.2	4	3tkd_CYZ_A_266 PDB CREDO	0.641	0.134	0.621	0.001
Rv3721c.2	4	3frq_ERY_B_195 PDB CREDO	0.633	0.141	0.614	0.002
Rv3721c.2	4	3tkd_CYZ_B_267 PDB CREDO	0.659	0.116	0.600	0.002
Rv3721c.2	4	3ut5_LOC_D_502 PDB CREDO	0.612	0.165	0.593	0.002
Rv3721c.2	4	1z2b_VLB_C_800 PDB CREDO	0.669	0.106	0.591	0.002
Rv3721c.2	30	1xkk_FMM_A_91 PDB CREDO	0.665	0.110	0.587	0.003
Rv3721c.2	4	3tne_RIT_A_401 PDB CREDO	0.605	0.173	0.586	0.003
Rv3721c.2	4	1hwi_115_D_3 PDB CREDO	0.604	0.175	0.585	0.003
Rv3721c.2	4	1hwi_115_B_1 PDB CREDO	0.603	0.175	0.584	0.003
Rv3721c.2	4	1cil_ETS_A_263 PDB CREDO	0.659	0.116	0.577	0.003
Rv3721c.2	4	1hwi_115_A_2 PDB CREDO	0.612	0.165	0.573	0.003
Rv3721c.2	4	3ut5_LOC_B_502 PDB CREDO	0.626	0.150	0.570	0.004
Rv3721c.2	4	2xpv_MIY_A_1209 PDB CREDO	0.691	0.088	0.565	0.004
Rv3721c.2	4	3tne_RIT_B_401 PDB CREDO	0.577	0.208	0.559	0.004
Rv3721c.2	4	1hwl_FBI_D_3 PDB CREDO	0.631	0.144	0.557	0.004
Rv3721c.2	4	3d91_REM_A_350 PDB CREDO	0.649	0.125	0.557	0.004
Rv3721c.2	4	2ab2_SNL_A_502 PDB CREDO	0.574	0.212	0.556	0.005
Rv3721c.2	4	1hwl_FBI_B_1 PDB CREDO	0.629	0.146	0.556	0.005
Rv3721c.2	4	2ab2_SNL_B_503 PDB CREDO	0.573	0.212	0.556	0.005
Rv3721c.2	4	1uwh_BAX_A_1723 PDB CREDO	0.609	0.168	0.555	0.005
Rv3721c.2	4	1uwh_BAX_B_1723 PDB CREDO	0.609	0.168	0.555	0.005
Rv3721c.2	4	2oax_SNL_C_3001 PDB CREDO	0.570	0.217	0.552	0.005
Rv3721c.2	4	1hwk_117_D_3 PDB CREDO	0.606	0.172	0.552	0.005
Rv3721c.2	4	1uwj_BAX_A_1723 PDB CREDO	0.700	0.080	0.551	0.005
Rv3721c.2	4	3d91_REM_B_350 PDB CREDO	0.641	0.133	0.550	0.005
Rv3721c.2	4	2aa5_STR_B_302 PDB CREDO	0.586	0.196	0.549	0.005
Rv3721c.2	4	3vhu_SNL_A_1001 PDB CREDO	0.565	0.224	0.547	0.005
Rv3721c.2	30	1t46_STI_A_3 PDB CREDO	0.653	0.122	0.547	0.005
Rv3721c.2	4	2aa5_STR_A_301 PDB CREDO	0.584	0.199	0.547	0.005
Rv3721c.2	4	2y6o_1N1_A_1892 PDB CREDO	0.545	0.251	0.545	0.005
Rv3721c.2	4	3frq_ERY_A_195 PDB CREDO	0.655	0.120	0.545	0.005
Rv3721c.2	4	2oax_SNL_B_2001 PDB CREDO	0.562	0.227	0.545	0.005
Rv3721c.2	4	1hwl_FBI_C_4 PDB CREDO	0.616	0.160	0.544	0.006
Rv3721c.2	4	3e22_LOC_D_700 PDB CREDO	0.561	0.229	0.544	0.006
Rv3721c.2	4	1xzx_T3_X_500 PDB CREDO	0.543	0.253	0.543	0.006
Rv3721c.2	4	1hwl_FBI_A_2 PDB CREDO	0.615	0.162	0.543	0.006
Rv3721c.2	4	1fm6_BRL_X_504 PDB CREDO	0.543	0.254	0.543	0.006
Rv3721c.2	4	1uwj_BAX_B_1723 PDB CREDO	0.633	0.142	0.543	0.006
Rv3721c.2	4	3uvv_T3_A_501 PDB CREDO	0.541	0.256	0.541	0.006
Rv3721c.2	4	3e22_LOC_B_700 PDB CREDO	0.559	0.232	0.541	0.006
Rv3721c.2	30	3sm2_478_A_126 PDB CREDO	0.581	0.202	0.540	0.006
Rv3721c.2	4	1p93_DEX_D_4999 PDB CREDO	0.557	0.234	0.540	0.006
Rv3721c.2	4	3jwq_VIA_D_901 PDB CREDO	0.616	0.160	0.540	0.006
Rv3721c.2	4	1hwk_117_B_1 PDB CREDO	0.665	0.110	0.538	0.006
Rv3721c.2	4	1hwk_117_C_4 PDB CREDO	0.627	0.148	0.538	0.006
Rv3721c.2	4	2h79_T3_A_1 PDB CREDO	0.573	0.213	0.537	0.006
Rv3721c.2	4	3mne_DEX_A_784 PDB CREDO	0.554	0.238	0.537	0.006
Rv3721c.2	4	1hwk_117_A_2 PDB CREDO	0.626	0.150	0.536	0.006
Rv3721c.2	4	1sa1_POD_B_700 PDB CREDO	0.625	0.150	0.536	0.006
Rv3721c.2	4	1sa1_POD_D_701 PDB CREDO	0.607	0.171	0.536	0.006
Rv3721c.2	4	1zgy_BRL_A_503 PDB CREDO	0.589	0.192	0.534	0.006
Rv3721c.2	4	1p93_DEX_C_3999 PDB CREDO	0.551	0.243	0.534	0.007
Rv3721c.2	4	2aa6_STR_A_401 PDB CREDO	0.569	0.218	0.534	0.007
Rv3721c.2	4	1bsx_T3_A_1 PDB CREDO	0.551	0.243	0.533	0.007
Rv3721c.2	4	1bsx_T3_B_2 PDB CREDO	0.551	0.243	0.533	0.007
Rv3721c.2	4	3gws_T3_X_500 PDB CREDO	0.551	0.243	0.533	0.007
Rv3721c.2	4	2aa6_STR_B_402 PDB CREDO	0.568	0.219	0.533	0.007
Rv3721c.2	4	2aax_PDN_B_503 PDB CREDO	0.566	0.222	0.530	0.007
Rv3721c.2	4	3gn8_DEX_A_247 PDB CREDO	0.548	0.247	0.530	0.007
Rv3721c.2	4	1m2z_DEX_A_301 PDB CREDO	0.547	0.248	0.530	0.007
Rv3721c.2	4	1m2z_DEX_D_401 PDB CREDO	0.546	0.249	0.529	0.007
Rv3721c.2	4	2aax_PDN_A_502 PDB CREDO	0.564	0.224	0.529	0.007
Rv3721c.2	4	3gn8_DEX_B_247 PDB CREDO	0.546	0.249	0.529	0.007
Rv3721c.2	4	1jg2_ADN_A_500 PDB CREDO	0.624	0.152	0.528	0.007
Rv3721c.2	4	3bbt_FMM_D_91 PDB CREDO	0.602	0.177	0.527	0.007
Rv3721c.2	4	3spk_TPV_A_100 PDB CREDO	0.581	0.202	0.527	0.007
Rv3721c.2	4	2nni_MTK_A_501 PDB CREDO	0.633	0.142	0.527	0.007
Rv3721c.2	30	1c6z_ROC_B_505 PDB CREDO	0.552	0.241	0.526	0.007
Rv3721c.2	4	3ln1_CEL_B_682 PDB CREDO	0.543	0.254	0.525	0.007
Rv3721c.2	30	2qak_1UN_A_1001 PDB CREDO	0.551	0.242	0.525	0.007
Rv3721c.2	30	2pym_1UN_A_1001 PDB CREDO	0.551	0.243	0.524	0.008
Rv3721c.2	4	3ln1_CEL_C_682 PDB CREDO	0.541	0.257	0.524	0.008
Rv3721c.2	30	2q63_1UN_A_1001 PDB CREDO	0.550	0.244	0.524	0.008
Rv3721c.2	4	3ln1_CEL_A_682 PDB CREDO	0.540	0.258	0.523	0.008
Rv3721c.2	30	2pyn_1UN_A_1001 PDB CREDO	0.549	0.246	0.522	0.008
Rv3721c.2	4	2h42_VIA_A_901 PDB CREDO	0.596	0.184	0.522	0.008
Rv3721c.2	30	2q64_1UN_B_1001 PDB CREDO	0.548	0.246	0.522	0.008
Rv3721c.2	4	1p93_DEX_B_2999 PDB CREDO	0.595	0.185	0.521	0.008
Rv3721c.2	4	3qt0_486_A_4 PDB CREDO	0.595	0.185	0.521	0.008
Rv3721c.2	4	3mnp_DEX_A_784 PDB CREDO	0.554	0.238	0.520	0.008
Rv3721c.2	4	1p93_DEX_A_1999 PDB CREDO	0.593	0.187	0.520	0.008
Rv3721c.2	4	2h77_T3_A_1 PDB CREDO	0.573	0.212	0.520	0.008
Rv3721c.2	4	1uob_PNN_A_1311 PDB CREDO	0.588	0.193	0.520	0.008
Rv3721c.2	4	3mno_DEX_A_784 PDB CREDO	0.553	0.240	0.519	0.008
Rv3721c.2	4	3k2h_LYA_B_514 PDB CREDO	0.635	0.140	0.519	0.008
Rv3721c.2	4	2oax_SNL_F_6001 PDB CREDO	0.585	0.198	0.517	0.008
Rv3721c.2	4	2oax_SNL_A_1001 PDB CREDO	0.584	0.199	0.516	0.009
Rv3721c.2	4	2oax_SNL_D_4001 PDB CREDO	0.583	0.200	0.515	0.009
Rv3721c.2	4	1ya3_STR_B_2001 PDB CREDO	0.608	0.170	0.515	0.009
Rv3721c.2	4	2oax_SNL_E_5001 PDB CREDO	0.582	0.201	0.514	0.009
Rv3721c.2	4	4eb6_VLB_C_503 PDB CREDO	0.652	0.123	0.514	0.009
Rv3721c.2	30	3gp0_NIL_A_1 PDB CREDO	0.598	0.182	0.514	0.009
Rv3721c.2	4	1hwi_115_C_4 PDB CREDO	0.606	0.172	0.513	0.009
Rv3721c.2	4	3ln1_CEL_D_682 PDB CREDO	0.585	0.197	0.513	0.009
Rv3721c.2	4	3ria_IVM_C_349 PDB CREDO	0.649	0.125	0.512	0.009
Rv3721c.2	4	3vn2_TLS_A_501 PDB CREDO	0.545	0.251	0.512	0.009
Rv3721c.2	4	2hw2_RFP_A_1200 PDB CREDO	0.528	0.275	0.512	0.009
Rv3721c.2	4	1a28_STR_B_2 PDB CREDO	0.512	0.300	0.512	0.009
Rv3721c.2	4	1ya3_STR_A_1001 PDB CREDO	0.604	0.174	0.512	0.009
Rv3721c.2	4	3rif_IVM_A_402 PDB CREDO	0.649	0.126	0.512	0.009
Rv3721c.2	4	3rif_IVM_D_402 PDB CREDO	0.649	0.126	0.512	0.009
Rv3721c.2	4	3h52_486_D_2 PDB CREDO	0.561	0.229	0.510	0.009
Rv3721c.2	4	1nhz_486_A_800 PDB CREDO	0.563	0.226	0.510	0.009
Rv3721c.2	4	1lhu_EST_A_301 PDB CREDO	0.623	0.152	0.509	0.009
Rv3721c.2	4	3ri5_IVM_C_350 PDB CREDO	0.646	0.128	0.509	0.009
Rv3721c.2	4	3rif_IVM_B_403 PDB CREDO	0.645	0.130	0.508	0.010
Rv3721c.2	4	3f4x_KLT_A_300 PDB CREDO	0.719	0.067	0.507	0.010
Rv3721c.2	4	1y0x_T44_X_500 PDB CREDO	0.557	0.234	0.507	0.010
Rv3721c.2	4	3h52_486_B_1 PDB CREDO	0.574	0.212	0.507	0.010
Rv3721c.2	4	1jg3_ADN_A_500 PDB CREDO	0.666	0.109	0.506	0.010
Rv3721c.2	4	1oq5_CEL_A_701 PDB CREDO	0.642	0.132	0.506	0.010
Rv3721c.2	4	1fm6_BRL_D_503 PDB CREDO	0.617	0.160	0.504	0.010
Rv3721c.2	30	3el4_ROC_A_100 PDB CREDO	0.525	0.279	0.501	0.011

Similarity to known drug target from sensitive sequence analysis

No drug targets

List of small molecules tested from TIBLE

Data not available

Off-target activity - ligand based from TIBLE

Data not available

Small molecules involved in protein-protein complex from TIMBAL .Proteins similar to Mtb based on sequence analysis.

Data not available

STITCH interactions

Chemical Name	Confidence score	Molecular Weight
thymidine triphosphatePubChem	0.9	482.168
deoxycytidine triphosphatePubChem	0.9	467.157
pyrophosphatePubChem	0.9	177.975
deoxyadenosine triphosphatePubChem	0.9	491.182
deoxyguanosine triphosphatePubChem	0.9	507.181