SInCRe - Rv3206c

Tuberculist information

Gene name	moeB1
Protein function	Probable molybdenum cofactor biosynthesis protein MoeB1 (MPT-synthase sulfurylase) (molybdopterin synthase sulphurylase)
Functional category(tuberculist)	intermediary metabolism and respiration
Gene location(kb)	3582.53
Molecular mass(da)	42141.4
External sites	TB Database TubercuList WebTB

Protein sequence

Number of amino acids : 392

	  		  	1    VSTSLPPLVEPASALSREEVARYSRHLIIPDLGVDGQKRLKNARVLVIGAGGLGAPTLLY   60
			  	61   LAAAGVGTIGIVDFDVVDESNLQRQVIHGVADVGRSKAQSARDSIVAINPLIRVRLHELR  120
			  	121  LAPSNAVDLFKQYDLILDGTDNFATRYLVNDAAVLAGKPYVWGSIYRFEGQASVFWEDAP  180
			  	181  DGLGVNYRDLYPEPPPPGMVPSCAEGGVLGIICASVASVMGTEAIKLITGIGETLLGRLL  240
			  	241  VYDALEMSYRTITIRKDPSTPKITELVDYEQFCGVVADDAAQAAKGSTITPRELRDWLDS  300
			  	301  GRKLALIDVRDPVEWDIVHIDGAQLIPKSLINSGEGLAKLPQDRTAVLYCKTGVRSAEAL  360
			  	361  AAVKKAGFSDAVHLQGGIVAWAKQMQPDMVMY

Known structures in the PDB

No Known structures

Number of amino acids : 392

Domains assigned based on sequence.

Mtb Structural proteome models

CHOPIN models

Profile-based domain assignment

Structural/Functional domain family	Pfam acc.no./SCOP ID	Domain Region
ThiF	PF00899	41-175
MoeZ_MoeB	PF05237	182-266
Rhodanese	PF00581	290-384

Mtb Structural Proteome models

Model Number	1
Model name	Rv3206c.2
Template	1GMX APDB CREDO
Template coverage	1_106
Template Identity(%)	21.9
Model coverage(%)	27.8
Normalized DOPE score	-1.21

Model Number	2
Model name	Rv3206c
Template	1JW9 BPDB CREDO
Template coverage	2_247
Template Identity(%)	37.2
Model coverage(%)	63.8
Normalized DOPE score	-0.541

Structure Models from Chopin

Model Number	1
Profile	c.111.1.1 - 3.40.50.720 Click for model details
zscore	54.65
Residue begin	13
Residue end	264

Model Number	2
Profile	c.46.1.3 - 3.40.250.10 Click for model details
zscore	20.57
Residue begin	290
Residue end	384

Model Number	3
Profile	c.46.1.3 - 3.40.250.10 Click for model details
zscore	13.02
Residue begin	265
Residue end	392

Model Number	4
Profile	c.111.1.2 Click for model details
zscore	9.68
Residue begin	16
Residue end	392

Binding pockets

STRING

Cytoscape Web will replace the contents of this div with protein-protein interaction network.

Protein interacting with Rv3206c	Gene name	Confidence Score
Rv1335	cysO	0.997
Rv3323c	moaX	0.983
Rv3323c	moaX	0.983
Rv1336	cysM	0.967
Rv3025c	iscS	0.956
Rv3119	moaE1	0.947
Rv0866	moaE2	0.937
Rv3117	cysA3	0.921
Rv0417	thiG	0.919
Rv0423c	thiC	0.907
Rv0423c	thiC	0.907

Potential ligand/drug binding sites

Protein Model	Pocket Number	Drug Binding Site	PMIN Score	Pvalue PMIN	PMAX Score	Pvalue PMAX
Rv3206c.2	6	3gp0_NIL_A_1 PDB CREDO	0.696	0.084	0.696	0.000
Rv3206c.2	6	1xkk_FMM_A_91 PDB CREDO	0.687	0.091	0.669	0.001
Rv3206c.2	6	2qxs_RAL_A_600 PDB CREDO	0.706	0.076	0.652	0.001
Rv3206c.2	6	2qxs_RAL_B_600 PDB CREDO	0.703	0.079	0.649	0.001
Rv3206c.2	1	3heg_BAX_A_1 PDB CREDO	0.687	0.091	0.646	0.001
Rv3206c.2	1	3gcs_BAX_A_401 PDB CREDO	0.706	0.076	0.644	0.001
Rv3206c.2	6	3cs9_NIL_C_600 PDB CREDO	0.647	0.127	0.630	0.001
Rv3206c.2	1	2jfa_RAL_B_600 PDB CREDO	0.628	0.147	0.628	0.001
Rv3206c.2	1	1err_RAL_B_600 PDB CREDO	0.626	0.149	0.626	0.001
Rv3206c.2	6	1t46_STI_A_3 PDB CREDO	0.642	0.132	0.625	0.001
Rv3206c.2	1	1err_RAL_A_600 PDB CREDO	0.625	0.150	0.625	0.001
Rv3206c.2	1	3hec_STI_A_1 PDB CREDO	0.644	0.130	0.625	0.001
Rv3206c.2	6	3ufn_ROC_A_401 PDB CREDO	0.623	0.152	0.623	0.001
Rv3206c.2	6	2xkw_P1B_A_1478 PDB CREDO	0.656	0.118	0.623	0.001
Rv3206c.2	6	3cs9_NIL_D_600 PDB CREDO	0.635	0.140	0.618	0.001
Rv3206c.2	1	4asd_BAX_A_1500 PDB CREDO	0.676	0.100	0.618	0.002
Rv3206c.2	6	3cs9_NIL_B_600 PDB CREDO	0.668	0.107	0.617	0.002
Rv3206c.2	1	2jfa_RAL_A_600 PDB CREDO	0.636	0.139	0.616	0.002
Rv3206c.2	6	3cs9_NIL_A_600 PDB CREDO	0.682	0.095	0.612	0.002
Rv3206c.2	1	2oiq_STI_A_1001 PDB CREDO	0.651	0.123	0.612	0.002
Rv3206c.2	1	3oez_STI_B_601 PDB CREDO	0.629	0.146	0.610	0.002
Rv3206c.2	6	3sm2_478_A_126 PDB CREDO	0.648	0.126	0.600	0.002
Rv3206c.2	1	1xzx_T3_X_500 PDB CREDO	0.638	0.137	0.599	0.002
Rv3206c.2	6	3gcs_BAX_A_401 PDB CREDO	0.769	0.038	0.598	0.002
Rv3206c.2	1	1bsx_T3_A_1 PDB CREDO	0.655	0.119	0.596	0.002
Rv3206c.2	1	1bsx_T3_B_2 PDB CREDO	0.655	0.119	0.596	0.002
Rv3206c.2	1	2pl0_STI_A_200 PDB CREDO	0.630	0.145	0.592	0.002
Rv3206c.2	1	3uvv_T3_A_501 PDB CREDO	0.630	0.145	0.592	0.002
Rv3206c.2	6	3heg_BAX_A_1 PDB CREDO	0.781	0.032	0.590	0.003
Rv3206c.2	1	2hyy_STI_B_600 PDB CREDO	0.624	0.151	0.587	0.003
Rv3206c.2	1	3gws_T3_X_500 PDB CREDO	0.645	0.130	0.586	0.003
Rv3206c.2	1	1qkn_RAL_A_600 PDB CREDO	0.641	0.133	0.583	0.003
Rv3206c.2	1	2y6o_1N1_A_1892 PDB CREDO	0.621	0.155	0.583	0.003
Rv3206c.2	1	1y0x_T44_X_500 PDB CREDO	0.596	0.184	0.578	0.003
Rv3206c.2	1	3oez_STI_A_601 PDB CREDO	0.667	0.109	0.574	0.003
Rv3206c.2	6	3b0w_DGX_B_1 PDB CREDO	0.657	0.117	0.574	0.003
Rv3206c.2	6	1opj_STI_A_3 PDB CREDO	0.638	0.136	0.573	0.003
Rv3206c.2	6	3el9_DR7_A_100 PDB CREDO	0.604	0.174	0.573	0.003
Rv3206c.2	6	3ogq_AB1_A_200 PDB CREDO	0.602	0.177	0.571	0.004
Rv3206c.2	6	1n49_RIT_B_301 PDB CREDO	0.635	0.139	0.571	0.004
Rv3206c.2	6	1opj_STI_B_4 PDB CREDO	0.635	0.140	0.570	0.004
Rv3206c.2	6	2qak_1UN_A_1001 PDB CREDO	0.627	0.148	0.566	0.004
Rv3206c.2	6	1c6z_ROC_B_505 PDB CREDO	0.626	0.149	0.566	0.004
Rv3206c.2	6	2q64_1UN_B_1001 PDB CREDO	0.626	0.149	0.565	0.004
Rv3206c.2	6	2pyn_1UN_A_1001 PDB CREDO	0.624	0.151	0.564	0.004
Rv3206c.2	6	1n49_RIT_D_401 PDB CREDO	0.682	0.095	0.563	0.004
Rv3206c.2	6	4asd_BAX_A_1500 PDB CREDO	0.723	0.065	0.563	0.004
Rv3206c.2	6	2pym_1UN_A_1001 PDB CREDO	0.622	0.154	0.561	0.004
Rv3206c.2	1	3v5w_8PR_A_701 PDB CREDO	0.617	0.160	0.561	0.004
Rv3206c.2	6	3oez_STI_A_601 PDB CREDO	0.679	0.098	0.560	0.004
Rv3206c.2	6	3spk_TPV_B_100 PDB CREDO	0.699	0.082	0.560	0.004
Rv3206c.2	1	2h79_T3_A_1 PDB CREDO	0.637	0.138	0.560	0.004
Rv3206c.2	1	3bbt_FMM_D_91 PDB CREDO	0.681	0.096	0.560	0.004
Rv3206c.2	1	2h77_T3_A_1 PDB CREDO	0.657	0.118	0.559	0.004
Rv3206c.2	1	3spk_TPV_B_100 PDB CREDO	0.630	0.145	0.559	0.004
Rv3206c.2	6	2q63_1UN_A_1001 PDB CREDO	0.618	0.158	0.558	0.004
Rv3206c.2	1	3cs9_NIL_A_600 PDB CREDO	0.702	0.079	0.556	0.005
Rv3206c.2	1	3spk_TPV_A_100 PDB CREDO	0.653	0.122	0.555	0.005
Rv3206c.2	1	2hyy_STI_C_600 PDB CREDO	0.644	0.130	0.555	0.005
Rv3206c.2	1	2hw2_RFP_A_1200 PDB CREDO	0.572	0.214	0.555	0.005
Rv3206c.2	2	3jw3_TOP_A_208 PDB CREDO	0.619	0.157	0.555	0.005
Rv3206c.2	6	1uwj_BAX_A_1723 PDB CREDO	0.652	0.123	0.553	0.005
Rv3206c.2	6	2jfa_RAL_B_600 PDB CREDO	0.778	0.034	0.553	0.005
Rv3206c.2	1	3ms9_STI_B_1 PDB CREDO	0.641	0.134	0.552	0.005
Rv3206c.2	1	2hyy_STI_A_600 PDB CREDO	0.640	0.134	0.552	0.005
Rv3206c.2	1	3mss_STI_B_1 PDB CREDO	0.640	0.134	0.552	0.005
Rv3206c.2	1	3mss_STI_D_1 PDB CREDO	0.640	0.135	0.551	0.005
Rv3206c.2	1	1uwh_BAX_A_1723 PDB CREDO	0.568	0.220	0.551	0.005
Rv3206c.2	6	1c6y_MK1_B_524 PDB CREDO	0.581	0.203	0.551	0.005
Rv3206c.2	1	2hyy_STI_D_600 PDB CREDO	0.639	0.136	0.550	0.005
Rv3206c.2	1	1uwh_BAX_B_1723 PDB CREDO	0.567	0.220	0.550	0.005
Rv3206c.2	6	1err_RAL_A_600 PDB CREDO	0.773	0.036	0.550	0.005
Rv3206c.2	1	3k5v_STI_B_2 PDB CREDO	0.637	0.137	0.549	0.005
Rv3206c.2	1	3mss_STI_A_1 PDB CREDO	0.637	0.138	0.549	0.005
Rv3206c.2	1	3pyy_STI_B_4 PDB CREDO	0.637	0.138	0.549	0.005
Rv3206c.2	1	3gvu_STI_A_1001 PDB CREDO	0.636	0.139	0.548	0.005
Rv3206c.2	1	3ms9_STI_A_1 PDB CREDO	0.636	0.139	0.548	0.005
Rv3206c.2	1	3mss_STI_C_1 PDB CREDO	0.636	0.139	0.548	0.005
Rv3206c.2	1	3pyy_STI_A_3 PDB CREDO	0.636	0.139	0.548	0.005
Rv3206c.2	1	1iep_STI_B_202 PDB CREDO	0.635	0.140	0.547	0.005
Rv3206c.2	1	1xkk_FMM_A_91 PDB CREDO	0.789	0.029	0.547	0.005
Rv3206c.2	1	1iep_STI_A_201 PDB CREDO	0.635	0.140	0.547	0.005
Rv3206c.2	6	3el0_1UN_A_201 PDB CREDO	0.626	0.150	0.546	0.005
Rv3206c.2	6	1err_RAL_B_600 PDB CREDO	0.768	0.038	0.546	0.005
Rv3206c.2	1	3gp0_NIL_A_1 PDB CREDO	0.768	0.038	0.546	0.005
Rv3206c.2	1	1fm6_BRL_X_504 PDB CREDO	0.581	0.203	0.545	0.005
Rv3206c.2	1	1s9p_DES_A_459 PDB CREDO	0.711	0.073	0.545	0.005
Rv3206c.2	6	3s56_ROC_A_201 PDB CREDO	0.574	0.211	0.545	0.005
Rv3206c.2	1	3oht_1N1_B_1000 PDB CREDO	0.710	0.073	0.545	0.005
Rv3206c.2	6	3ggu_017_B_201 PDB CREDO	0.559	0.232	0.544	0.005
Rv3206c.2	1	1uwj_BAX_B_1723 PDB CREDO	0.596	0.184	0.544	0.005
Rv3206c.2	1	2fum_MIX_D_3539 PDB CREDO	0.661	0.114	0.544	0.006
Rv3206c.2	1	1sa1_POD_B_700 PDB CREDO	0.595	0.185	0.543	0.006
Rv3206c.2	6	2oiq_STI_A_1001 PDB CREDO	0.719	0.067	0.543	0.006
Rv3206c.2	1	3cs9_NIL_B_600 PDB CREDO	0.705	0.077	0.543	0.006
Rv3206c.2	6	3bjw_SVR_E_503 PDB CREDO	0.572	0.214	0.543	0.006
Rv3206c.2	1	2qxs_RAL_B_600 PDB CREDO	0.704	0.077	0.542	0.006
Rv3206c.2	1	1zgy_BRL_A_503 PDB CREDO	0.637	0.137	0.542	0.006
Rv3206c.2	6	3k5v_STI_A_2 PDB CREDO	0.621	0.155	0.542	0.006
Rv3206c.2	6	1hxw_RIT_B_301 PDB CREDO	0.555	0.237	0.541	0.006
Rv3206c.2	1	1sa1_POD_D_701 PDB CREDO	0.575	0.211	0.540	0.006
Rv3206c.2	1	2qxs_RAL_A_600 PDB CREDO	0.701	0.080	0.540	0.006
Rv3206c.2	6	1hsh_MK1_A_401 PDB CREDO	0.569	0.218	0.540	0.006
Rv3206c.2	6	3ekq_ROC_A_100 PDB CREDO	0.583	0.199	0.539	0.006
Rv3206c.2	1	1t7j_478_A_200 PDB CREDO	0.555	0.237	0.538	0.006
Rv3206c.2	1	3erd_DES_B_800 PDB CREDO	0.727	0.062	0.538	0.006
Rv3206c.2	6	2jfa_RAL_A_600 PDB CREDO	0.780	0.033	0.537	0.006
Rv3206c.2	1	1s9p_DES_D_600 PDB CREDO	0.699	0.081	0.537	0.006
Rv3206c.2	1	1opj_STI_A_3 PDB CREDO	0.678	0.099	0.537	0.006
Rv3206c.2	1	3ogp_017_A_200 PDB CREDO	0.568	0.219	0.535	0.006
Rv3206c.2	6	2fxd_DR7_A_102 PDB CREDO	0.563	0.226	0.534	0.006
Rv3206c.2	6	3lzv_017_A_200 PDB CREDO	0.612	0.165	0.534	0.006
Rv3206c.2	1	2xkw_P1B_B_1475 PDB CREDO	0.721	0.066	0.534	0.007
Rv3206c.2	6	1ya4_CTX_A_1 PDB CREDO	0.621	0.155	0.534	0.007
Rv3206c.2	6	3pyy_STI_B_4 PDB CREDO	0.645	0.130	0.532	0.007
Rv3206c.2	6	1rl8_RIT_A_9001 PDB CREDO	0.604	0.175	0.532	0.007
Rv3206c.2	1	1opj_STI_B_4 PDB CREDO	0.672	0.104	0.532	0.007
Rv3206c.2	6	1sa1_POD_B_700 PDB CREDO	0.683	0.095	0.531	0.007
Rv3206c.2	6	2nnk_ROC_A_401 PDB CREDO	0.633	0.142	0.531	0.007
Rv3206c.2	1	1n49_RIT_D_401 PDB CREDO	0.617	0.159	0.531	0.007
Rv3206c.2	6	3bjw_SVR_B_501 PDB CREDO	0.545	0.251	0.531	0.007
Rv3206c.2	6	3rgf_BAX_A_465 PDB CREDO	0.625	0.150	0.531	0.007
Rv3206c.2	1	3erd_DES_A_600 PDB CREDO	0.717	0.068	0.531	0.007
Rv3206c.2	6	2pl0_STI_A_200 PDB CREDO	0.701	0.080	0.529	0.007
Rv3206c.2	1	2o4n_TPV_A_300 PDB CREDO	0.545	0.251	0.528	0.007
Rv3206c.2	6	3ndt_ROC_D_100 PDB CREDO	0.629	0.146	0.528	0.007
Rv3206c.2	1	3k5v_STI_A_2 PDB CREDO	0.649	0.126	0.528	0.007
Rv3206c.2	6	2hyy_STI_A_600 PDB CREDO	0.639	0.135	0.528	0.007
Rv3206c.2	6	3mss_STI_A_1 PDB CREDO	0.639	0.135	0.528	0.007
Rv3206c.2	6	3mss_STI_C_1 PDB CREDO	0.639	0.136	0.527	0.007
Rv3206c.2	6	3mss_STI_D_1 PDB CREDO	0.639	0.136	0.527	0.007
Rv3206c.2	6	3k5v_STI_B_2 PDB CREDO	0.639	0.136	0.527	0.007
Rv3206c.2	6	2hyy_STI_C_600 PDB CREDO	0.638	0.137	0.526	0.007
Rv3206c.2	1	3qt0_486_A_4 PDB CREDO	0.639	0.135	0.526	0.007
Rv3206c.2	6	3ms9_STI_B_1 PDB CREDO	0.637	0.138	0.526	0.007
Rv3206c.2	1	1d4y_TPV_A_501 PDB CREDO	0.542	0.256	0.525	0.007
Rv3206c.2	6	1sdv_MK1_B_902 PDB CREDO	0.539	0.259	0.525	0.007
Rv3206c.2	6	3ucb_017_A_201 PDB CREDO	0.625	0.150	0.525	0.007
Rv3206c.2	6	3mss_STI_B_1 PDB CREDO	0.636	0.139	0.525	0.007
Rv3206c.2	6	3pyy_STI_A_3 PDB CREDO	0.636	0.139	0.525	0.007
Rv3206c.2	1	1uwj_BAX_A_1723 PDB CREDO	0.627	0.148	0.525	0.007
Rv3206c.2	6	1iep_STI_A_201 PDB CREDO	0.636	0.139	0.525	0.007
Rv3206c.2	6	3el4_ROC_A_100 PDB CREDO	0.640	0.135	0.524	0.008
Rv3206c.2	6	3bjw_SVR_F_502 PDB CREDO	0.538	0.261	0.524	0.008
Rv3206c.2	1	1t46_STI_A_3 PDB CREDO	0.718	0.068	0.524	0.008
Rv3206c.2	6	3bjw_SVR_H_504 PDB CREDO	0.538	0.262	0.524	0.008
Rv3206c.2	1	1uob_PNN_A_1311 PDB CREDO	0.557	0.235	0.524	0.008
Rv3206c.2	6	1iep_STI_B_202 PDB CREDO	0.634	0.140	0.524	0.008
Rv3206c.2	6	3gvu_STI_A_1001 PDB CREDO	0.634	0.140	0.524	0.008
Rv3206c.2	6	3ms9_STI_A_1 PDB CREDO	0.634	0.140	0.524	0.008
Rv3206c.2	6	2f80_017_B_301 PDB CREDO	0.580	0.204	0.523	0.008
Rv3206c.2	6	1hsh_MK1_C_402 PDB CREDO	0.552	0.242	0.523	0.008
Rv3206c.2	6	2hyy_STI_D_600 PDB CREDO	0.634	0.141	0.523	0.008
Rv3206c.2	1	3cs9_NIL_C_600 PDB CREDO	0.717	0.069	0.523	0.008
Rv3206c.2	6	1hxb_ROC_A_100 PDB CREDO	0.579	0.205	0.523	0.008
Rv3206c.2	6	2r5p_MK1_B_902 PDB CREDO	0.537	0.263	0.523	0.008
Rv3206c.2	6	1y0x_T44_X_500 PDB CREDO	0.711	0.072	0.522	0.008
Rv3206c.2	2	3vkx_T3_A_301 PDB CREDO	0.639	0.136	0.521	0.008
Rv3206c.2	6	2r5p_MK1_D_902 PDB CREDO	0.535	0.265	0.521	0.008
Rv3206c.2	2	1pcg_EST_B_2 PDB CREDO	0.701	0.080	0.521	0.008
Rv3206c.2	2	1qku_EST_C_600 PDB CREDO	0.701	0.080	0.521	0.008
Rv3206c.2	2	1ere_EST_E_600 PDB CREDO	0.698	0.082	0.519	0.008
Rv3206c.2	1	3cs9_NIL_D_600 PDB CREDO	0.711	0.072	0.519	0.008
Rv3206c.2	1	3so9_017_A_100 PDB CREDO	0.535	0.265	0.519	0.008
Rv3206c.2	6	2w8y_486_A_1000 PDB CREDO	0.665	0.110	0.518	0.008
Rv3206c.2	1	3rgf_BAX_A_465 PDB CREDO	0.618	0.158	0.517	0.008
Rv3206c.2	2	1ere_EST_A_600 PDB CREDO	0.696	0.084	0.517	0.008
Rv3206c.2	2	1g50_EST_B_1600 PDB CREDO	0.696	0.084	0.517	0.008
Rv3206c.2	2	1qku_EST_A_600 PDB CREDO	0.696	0.084	0.517	0.008
Rv3206c.2	6	2fxe_DR7_A_102 PDB CREDO	0.530	0.272	0.517	0.008
Rv3206c.2	6	3eky_DR7_A_100 PDB CREDO	0.530	0.273	0.516	0.009
Rv3206c.2	1	3e22_LOC_B_700 PDB CREDO	0.532	0.269	0.516	0.009
Rv3206c.2	2	1ere_EST_B_600 PDB CREDO	0.694	0.085	0.516	0.009
Rv3206c.2	2	1qku_EST_B_600 PDB CREDO	0.694	0.085	0.516	0.009
Rv3206c.2	6	1sa1_POD_D_701 PDB CREDO	0.682	0.095	0.516	0.009
Rv3206c.2	6	3uvv_T3_A_501 PDB CREDO	0.773	0.036	0.516	0.009
Rv3206c.2	6	3em4_DR7_V_100 PDB CREDO	0.529	0.274	0.515	0.009
Rv3206c.2	1	3e22_LOC_D_700 PDB CREDO	0.532	0.270	0.515	0.009
Rv3206c.2	6	3k4v_ROC_D_201 PDB CREDO	0.643	0.131	0.515	0.009
Rv3206c.2	2	1gwr_EST_B_600 PDB CREDO	0.693	0.086	0.515	0.009
Rv3206c.2	1	3vn2_TLS_A_501 PDB CREDO	0.514	0.297	0.514	0.009
Rv3206c.2	2	1gwr_EST_A_600 PDB CREDO	0.691	0.087	0.514	0.009
Rv3206c.2	6	3kk6_CEL_B_1701 PDB CREDO	0.556	0.235	0.514	0.009
Rv3206c.2	6	1xzx_T3_X_500 PDB CREDO	0.768	0.038	0.513	0.009
Rv3206c.2	6	2hyy_STI_B_600 PDB CREDO	0.678	0.099	0.512	0.009
Rv3206c.2	6	1sh9_RIT_B_301 PDB CREDO	0.540	0.258	0.512	0.009
Rv3206c.2	6	1k6c_MK1_B_902 PDB CREDO	0.624	0.151	0.511	0.009
Rv3206c.2	6	3em4_DR7_A_100 PDB CREDO	0.539	0.260	0.511	0.009
Rv3206c.2	2	1g50_EST_C_2600 PDB CREDO	0.784	0.031	0.510	0.009
Rv3206c.2	6	1uwj_BAX_B_1723 PDB CREDO	0.655	0.120	0.510	0.009
Rv3206c.2	2	3ret_SAL_B_201 PDB CREDO	0.538	0.262	0.509	0.009
Rv3206c.2	6	3h52_486_A_3 PDB CREDO	0.695	0.085	0.509	0.009
Rv3206c.2	1	3b0w_DGX_B_1 PDB CREDO	0.625	0.151	0.508	0.010
Rv3206c.2	6	3pwr_ROC_A_401 PDB CREDO	0.591	0.190	0.508	0.010
Rv3206c.2	2	2j7x_EST_A_1454 PDB CREDO	0.781	0.032	0.508	0.010
Rv3206c.2	2	1a52_EST_A_1 PDB CREDO	0.780	0.033	0.507	0.010
Rv3206c.2	2	1qkt_EST_A_600 PDB CREDO	0.780	0.033	0.507	0.010
Rv3206c.2	1	2w8y_486_A_1000 PDB CREDO	0.554	0.238	0.506	0.010
Rv3206c.2	2	1ere_EST_C_600 PDB CREDO	0.778	0.034	0.506	0.010
Rv3206c.2	2	1ere_EST_D_600 PDB CREDO	0.778	0.034	0.506	0.010
Rv3206c.2	2	1pcg_EST_A_1 PDB CREDO	0.778	0.034	0.506	0.010
Rv3206c.2	6	3ogp_017_B_200 PDB CREDO	0.612	0.165	0.505	0.010
Rv3206c.2	2	1ere_EST_F_600 PDB CREDO	0.777	0.034	0.505	0.010
Rv3206c.2	2	3hm1_J3Z_B_1 PDB CREDO	0.777	0.034	0.505	0.010
Rv3206c.2	2	3hgx_SAL_B_104 PDB CREDO	0.533	0.268	0.505	0.010
Rv3206c.2	2	1xbb_STI_A_1 PDB CREDO	0.589	0.193	0.505	0.010
Rv3206c.2	6	3h52_486_B_1 PDB CREDO	0.668	0.107	0.505	0.010
Rv3206c.2	1	1d4s_TPV_A_201 PDB CREDO	0.592	0.189	0.504	0.010
Rv3206c.2	2	3fl9_TOP_E_200 PDB CREDO	0.562	0.228	0.504	0.010
Rv3206c.2	2	3fl9_TOP_F_200 PDB CREDO	0.562	0.228	0.504	0.010
Rv3206c.2	1	3h52_486_A_3 PDB CREDO	0.519	0.289	0.503	0.010
Rv3206c.2	1	3h52_486_D_2 PDB CREDO	0.519	0.289	0.503	0.010
Rv3206c.2	6	2b60_RIT_B_100 PDB CREDO	0.502	0.316	0.502	0.011
Rv3206c.2	2	1a52_EST_B_2 PDB CREDO	0.771	0.037	0.501	0.011
Rv3206c.2	6	1uwh_BAX_B_1723 PDB CREDO	0.683	0.094	0.501	0.011
Rv3206c.2	1	2xkw_P1B_A_1478 PDB CREDO	0.741	0.053	0.500	0.011

Similarity to known drug target from sensitive sequence analysis

No drug targets

List of small molecules tested from TIBLE

Data not available

Off-target activity - ligand based from TIBLE

Data not available

Small molecules involved in protein-protein complex from TIMBAL .Proteins similar to Mtb based on sequence analysis.

Data not available

STITCH interactions

No high confidence interactions