SInCRe - Rv3323c

Tuberculist information

Gene name	moaX
Protein function	Probable MoaD-MoaE fusion protein MoaX
Functional category(tuberculist)	intermediary metabolism and respiration
Gene location(kb)	3709.05
Molecular mass(da)	24050.4
External sites	TB Database TubercuList WebTB

Protein sequence

Number of amino acids : 221

	  		  	1    MITVNVLYFGAVREACKVAHEKISLESGTTVDGLVDQLQIDYPPLADFRKRVRMAVNESI   60
			  	61   APASTILDDGDTVAFIPQVAGGSDVYCRLTDEPLSVDEVLNAISGPSQGGAVIFVGTVRN  120
			  	121  NNNGHEVTKLYYEAYPAMVHRTLMDIIEECERQADGVRVAVAHRTGELRIGDAAVVIGAS  180
			  	181  APHRAAAFDAARMCIERLKQDVPIWKKEFALDGVEWVANRP

Known structures in the PDB

No Known structures

Number of amino acids : 221

Domains assigned based on sequence.

Mtb Structural proteome models

CHOPIN models

Profile-based domain assignment

Structural/Functional domain family	Pfam acc.no./SCOP ID	Domain Region
ThiS	PF02597	6-82
MoaE	PF02391	86-202

Mtb Structural Proteome models

Model Number	1
Model name	Rv3323c.1
Template	1VJK APDB CREDO
Template coverage	2_88
Template Identity(%)	29.1
Model coverage(%)	35.3
Normalized DOPE score	-1.323

Model Number	2
Model name	Rv3323c
Template	1FM0 EPDB CREDO
Template coverage	2_141
Template Identity(%)	34.6
Model coverage(%)	62.4
Normalized DOPE score	-0.488

Structure Models from Chopin

Model Number	1
Profile	d.41.5.1 - 3.90.1170.40 Click for model details
zscore	28.69
Residue begin	83
Residue end	221

Model Number	2
Profile	d.15.3.1 - 3.10.20.30 Click for model details
zscore	19.27
Residue begin	1
Residue end	82

Binding pockets

STRING

Cytoscape Web will replace the contents of this div with protein-protein interaction network.

Protein interacting with Rv3323c	Gene name	Confidence Score
Rv3109	moaA1	0.998
Rv3109	moaA1	0.998
Rv3109	moaA1	0.998
Rv3324c	moaC3	0.997
Rv3111	moaC1	0.99
Rv3116	moeB2	0.987
Rv3116	moeB2	0.987
Rv3116	moeB2	0.987
Rv0869c	moaA2	0.984
Rv0869c	moaA2	0.984
Rv0869c	moaA2	0.984
Rv3206c	moeB1	0.983
Rv3206c	moeB1	0.983
Rv3206c	moeB1	0.983
Rv0864	moaC2	0.971
Rv0866	moaE2	0.911
Rv3119	moaE1	0.91

Potential ligand/drug binding sites

Protein Model	Pocket Number	Drug Binding Site	PMIN Score	Pvalue PMIN	PMAX Score	Pvalue PMAX
Rv3323c.1	1	2zva_1N1_A_513 PDB CREDO	0.651	0.123	0.602	0.002
Rv3323c.1	1	3qlg_1N1_A_601 PDB CREDO	0.620	0.156	0.597	0.002
Rv3323c.1	1	3g5d_1N1_A_1 PDB CREDO	0.616	0.160	0.593	0.002
Rv3323c.1	1	3g5d_1N1_B_1 PDB CREDO	0.616	0.160	0.593	0.002
Rv3323c.1	1	1s9p_DES_B_459 PDB CREDO	0.635	0.139	0.588	0.003
Rv3323c.1	1	3qlg_1N1_B_601 PDB CREDO	0.610	0.167	0.587	0.003
Rv3323c.1	1	1s9p_DES_C_500 PDB CREDO	0.633	0.142	0.586	0.003
Rv3323c.1	1	1kij_NOV_B_444 PDB CREDO	0.572	0.214	0.572	0.003
Rv3323c.1	1	2j7y_E3O_A_1454 PDB CREDO	0.567	0.220	0.567	0.004
Rv3323c.1	1	3ols_EST_A_600 PDB CREDO	0.636	0.139	0.565	0.004
Rv3323c.1	1	3ols_EST_B_600 PDB CREDO	0.636	0.139	0.565	0.004
Rv3323c.1	1	2cbr_A80_A_201 PDB CREDO	0.585	0.198	0.563	0.004
Rv3323c.1	1	1g50_EST_A_600 PDB CREDO	0.633	0.142	0.562	0.004
Rv3323c.1	1	3erd_DES_A_600 PDB CREDO	0.626	0.150	0.560	0.004
Rv3323c.1	1	3uud_EST_B_600 PDB CREDO	0.629	0.146	0.560	0.004
Rv3323c.1	1	3uud_EST_A_600 PDB CREDO	0.628	0.147	0.558	0.004
Rv3323c.1	1	2yja_EST_B_1550 PDB CREDO	0.626	0.149	0.557	0.004
Rv3323c.1	1	3oht_1N1_A_1000 PDB CREDO	0.571	0.215	0.550	0.005
Rv3323c.1	1	1s9p_DES_D_600 PDB CREDO	0.634	0.140	0.548	0.005
Rv3323c.1	1	2fum_MIX_B_1539 PDB CREDO	0.616	0.161	0.547	0.005
Rv3323c.1	1	2uxo_TAC_B_1211 PDB CREDO	0.616	0.161	0.547	0.005
Rv3323c.1	1	1s9p_DES_A_459 PDB CREDO	0.631	0.144	0.545	0.005
Rv3323c.1	1	2gqg_1N1_A_501 PDB CREDO	0.609	0.169	0.545	0.005
Rv3323c.1	1	3erd_DES_B_800 PDB CREDO	0.606	0.172	0.542	0.006
Rv3323c.1	1	2y7j_B49_B_1294 PDB CREDO	0.608	0.169	0.541	0.006
Rv3323c.1	1	3bbt_FMM_B_91 PDB CREDO	0.537	0.262	0.537	0.006
Rv3323c.1	1	2fum_MIX_D_3539 PDB CREDO	0.666	0.109	0.537	0.006
Rv3323c.1	1	3k54_1N1_A_1 PDB CREDO	0.575	0.210	0.534	0.006
Rv3323c.1	1	2xkw_P1B_B_1475 PDB CREDO	0.592	0.188	0.530	0.007
Rv3323c.1	1	3kw2_ADN_A_300 PDB CREDO	0.549	0.246	0.528	0.007
Rv3323c.1	1	2fum_MIX_A_539 PDB CREDO	0.589	0.192	0.527	0.007
Rv3323c.1	1	3ti1_B49_A_299 PDB CREDO	0.544	0.253	0.523	0.008
Rv3323c.1	1	3kw2_ADN_B_300 PDB CREDO	0.563	0.226	0.521	0.008
Rv3323c.1	1	1qkn_RAL_A_600 PDB CREDO	0.713	0.071	0.519	0.008
Rv3323c.1	1	3oht_1N1_B_1000 PDB CREDO	0.600	0.179	0.518	0.008
Rv3323c.1	1	1kij_NOV_A_400 PDB CREDO	0.643	0.131	0.518	0.008
Rv3323c.1	1	2j7x_EST_A_1454 PDB CREDO	0.659	0.116	0.517	0.008
Rv3323c.1	1	3oct_1N1_A_663 PDB CREDO	0.616	0.160	0.514	0.009
Rv3323c.1	1	3lfa_1N1_A_361 PDB CREDO	0.627	0.148	0.513	0.009
Rv3323c.1	1	3oll_EST_A_600 PDB CREDO	0.654	0.121	0.513	0.009
Rv3323c.1	1	3oll_EST_B_600 PDB CREDO	0.654	0.121	0.513	0.009
Rv3323c.1	1	1a52_EST_A_1 PDB CREDO	0.653	0.121	0.512	0.009
Rv3323c.1	1	1a52_EST_B_2 PDB CREDO	0.652	0.122	0.512	0.009
Rv3323c.1	1	1g50_EST_C_2600 PDB CREDO	0.652	0.122	0.512	0.009
Rv3323c.1	1	1mx1_THA_D_4 PDB CREDO	0.553	0.240	0.512	0.009
Rv3323c.1	1	3hm1_J3Z_B_1 PDB CREDO	0.651	0.123	0.511	0.009
Rv3323c.1	1	1jzs_MRC_A_1301 PDB CREDO	0.510	0.303	0.510	0.009
Rv3323c.1	1	1qkt_EST_A_600 PDB CREDO	0.650	0.124	0.510	0.009
Rv3323c.1	1	3oez_STI_B_601 PDB CREDO	0.745	0.050	0.509	0.009
Rv3323c.1	1	1ere_EST_C_600 PDB CREDO	0.648	0.127	0.508	0.010
Rv3323c.1	1	1mx1_THA_F_6 PDB CREDO	0.549	0.245	0.508	0.010
Rv3323c.1	1	1ere_EST_D_600 PDB CREDO	0.647	0.128	0.507	0.010
Rv3323c.1	1	1ere_EST_F_600 PDB CREDO	0.647	0.128	0.507	0.010
Rv3323c.1	1	1fm6_BRL_D_503 PDB CREDO	0.586	0.196	0.506	0.010
Rv3323c.1	1	2ocf_EST_A_596 PDB CREDO	0.645	0.130	0.506	0.010
Rv3323c.1	1	3qgz_ADN_A_127 PDB CREDO	0.541	0.257	0.502	0.011
Rv3323c.1	1	1pcg_EST_A_1 PDB CREDO	0.638	0.136	0.501	0.011
Rv3323c.1	1	3qt0_486_A_4 PDB CREDO	0.621	0.155	0.500	0.011

Similarity to known drug target from sensitive sequence analysis

No drug targets

List of small molecules tested from TIBLE

Data not available

Off-target activity - ligand based from TIBLE

Data not available

Small molecules involved in protein-protein complex from TIMBAL .Proteins similar to Mtb based on sequence analysis.

Data not available

STITCH interactions

Chemical Name	Confidence score	Molecular Weight
molybdopterinPubChem	0.767	397.368
molybdenum cofactorPubChem	0.741	522.283