SInCRe - Rv1311

Tuberculist information

Gene name	atpC
Protein function	Probable ATP synthase epsilon chain AtpC
Functional category(tuberculist)	intermediary metabolism and respiration
Gene location(kb)	1467.31
Molecular mass(da)	13134.8
External sites	TB Database TubercuList WebTB

Protein sequence

Number of amino acids : 121

	  		  	1    MAELNVEIVAVDRNIWSGTAKFLFTRTTVGEIGILPRHIPLVAQLVDDAMVRVEREGEKD   60
			  	61   LRIAVDGGFLSVTEEGVSILAESAEFESEIDEAAAKQDSESDDPRIAARGRARLRAVGAI  120
			  	121  D

Known structures in the PDB

	PDB ID	2LX5
	Total residue count	18
	Number of chains	1
	Method	NMR
	Resolution	N/A

Number of amino acids : 121

Domains assigned based on sequence.

Mtb Structural proteome models

CHOPIN models

Profile-based domain assignment

Structural/Functional domain family	Pfam acc.no./SCOP ID	Domain Region
ATP-synt_DE_N	PF02823	4-84

Mtb Structural Proteome models

Model Number	1
Model name	Rv1311
Template	1FS0 EPDB CREDO
Template coverage	5_131
Template Identity(%)	30.1
Model coverage(%)	92.6
Normalized DOPE score	-0.155

Structure Models from Chopin

Model Number	1
Profile	2.60.15.10 Click for model details
zscore	23.21
Residue begin	1
Residue end	91

Binding pockets

STRING

Cytoscape Web will replace the contents of this div with protein-protein interaction network.

Protein interacting with Rv1311	Gene name	Confidence Score
Rv1310	atpD	0.999
Rv1308	atpA	0.999
Rv1308	atpA	0.999
Rv1304	atpB	0.999
Rv1308	atpA	0.999
Rv1305	atpE	0.999
Rv1309	atpG	0.999
Rv1306	atpF	0.999
Rv1310	atpD	0.999
Rv1310	atpD	0.999
Rv1307	atpH	0.991
Rv1307	atpH	0.991
Rv0733	adk	0.977
Rv3628	ppa	0.913

Potential ligand/drug binding sites

No binding sites identified

Similarity to known drug target from sensitive sequence analysis

No drug targets

List of small molecules tested from TIBLE

Data not available

Off-target activity - ligand based from TIBLE

Data not available

Small molecules involved in protein-protein complex from TIMBAL .Proteins similar to Mtb based on sequence analysis.

Data not available

STITCH interactions

Chemical Name	Confidence score	Molecular Weight
H(+)PubChem	0.909	2.01588
deuteriumPubChem	0.908	2.01588
phosphatePubChem	0.9	96.9872
protiumPubChem	0.9	2.01576
adenosine monophosphatePubChem	0.9	347.221
deoxyadenosine triphosphatePubChem	0.9	491.182
hydroxyl radicalsPubChem	0.9	17.0073
adenosine diphosphatePubChem	0.9	427.201
adenosine triphosphatePubChem	0.9	507.181