SInCRe - Rv2383c

Tuberculist information

Gene name	mbtB
Protein function	Phenyloxazoline synthase MbtB (phenyloxazoline synthetase)
Functional category(tuberculist)	lipid metabolism
Gene location(kb)	2671.59
Molecular mass(da)	151602
External sites	TB Database TubercuList WebTB

Protein sequence

Number of amino acids : 1414

	  		  	1    VVHATACSEIIRAEVAELLGVRADALHPGANLVGQGLDSIRMMSLVGRWRRKGIAVDFAT   60
			  	61   LAATPTIEAWSQLVSAGTGVAPTAVAAPGDAGLSQEGEPFPLAPMQHAMWVGRHDHQQLG  120
			  	121  GVAGHLYVEFDGARVDPDRLRAAATRLALRHPMLRVQFLPDGTQRIPPAAGSRDFPISVA  180
			  	181  DLRHVAPDVVDQRLAGIRDAKSHQQLDGAVFELALTLLPGERTRLHVDLDMQAADAMSYR  240
			  	241  ILLADLAALYDGREPPALGYTYREYRQAIEAEETLPQPVRDADRDWWAQRIPQLPDPPAL  300
			  	301  PTRAGGERDRRRSTRRWHWLDPQTRDALFARARARGITPAMTLAAAFANVLARWSASSRF  360
			  	361  LLNLPLFSRQALHPDVDLLVGDFTSSLLLDVDLTGARTAAARAQAVQEALRSAAGHSAYP  420
			  	421  GLSVLRDLSRHRGTQVLAPVVFTSALGLGDLFCPDVTEQFGTPGWIISQGPQVLLDAQVT  480
			  	481  EFDGGVLVNWDVREGVFAPGVIDAMFTHQVDELLRLAAGDDAWDAPSPSALPAAQRAVRA  540
			  	541  ALNGRTAAPSTEALHDGFFRQAQQQPDAPAVFASSGDLSYAQLRDQASAVAAALRAAGLR  600
			  	601  VGDTVAVLGPKTGEQVAAVLGILAAGGVYLPIGVDQPRDRAERILATGSVNLALVCGPPC  660
			  	661  QVRVPVPTLLLADVLAAAPAEFVPGPSDPTALAYVLFTSGSTGEPKGVEVAHDAAMNTVE  720
			  	721  TFIRHFELGAADRWLALATLECDMSVLDIFAALRSGGAIVVVDEAQRRDPDAWARLIDTY  780
			  	781  EVTALNFMPGWLDMLLEVGGGRLSSLRAVAVGGDWVRPDLARRLQVQAPSARFAGLGGAT  840
			  	841  ETAVHATIFEVQDAANLPPDWASVPYGVPFPNNACRVVADSGDDCPDWVAGELWVSGRGI  900
			  	901  ARGYRGRPELTAERFVEHDGRTWYRTGDLARYWHDGTLEFVGRADHRVKISGYRVELGEI  960
			  	961  EAALQRLPGVHAAAATVLPGGSDVLAAAVCVDDAGVTAESIRQQLADLVPAHMIPRHVTL 1020
			  	1021 LDRIPFTDSGKIDRAEVGALLAAEVERSGDRSAPYAAPRTVLQRALRRIVADILGRANDA 1080
			  	1081 VGVHDDFFALGGDSVLATQVVAGIRRWLDSPSLMVADMFAARTIAALAQLLTGREANADR 1140
			  	1141 LELVAEVYLEIANMTSADVMAALDPIEQPAQPAFKPWVKRFTGTDKPGAVLVFPHAGGAA 1200
			  	1201 AAYRWLAKSLVANDVDTFVVQYPQRADRRSHPAADSIEALALELFEAGDWHLTAPLTLFG 1260
			  	1261 HCMGAIVAFEFARLAERNGVPVRALWASSGQAPSTVAASGPLPTADRDVLADMVDLGGTD 1320
			  	1321 PVLLEDEEFVELLVPAVKADYRALSGYSCPPDVRIRANIHAVGGNRDHRISREMLTSWET 1380
			  	1381 HTSGRFTLSHFDGGHFYLNDHLDAVARMVSADVR

Known structures in the PDB

No Known structures

Number of amino acids : 1414

Domains assigned based on sequence.

Mtb Structural proteome models

CHOPIN models

Profile-based domain assignment

Structural/Functional domain family	Pfam acc.no./SCOP ID	Domain Region
PP-binding	PF00550	9-74
Condensation	PF00668	96-394
NRPS	PF08415	416-472
AMP-binding	PF00501	558-951
AMP-binding_C	PF13193	959-1031
PP-binding	PF00550	1064-1131
Thioesterase	PF00975	1188-1413

Mtb Structural Proteome models

Model Number	1
Model name	Rv2383c.1
Template	2FQ1 APDB CREDO
Template coverage	212_283
Template Identity(%)	38.9
Model coverage(%)	5.1
Normalized DOPE score	-0.677

Model Number	2
Model name	Rv2383c.6
Template	1DNY APDB CREDO
Template coverage	8_83
Template Identity(%)	35.5
Model coverage(%)	5.5
Normalized DOPE score	-0.465

Model Number	3
Model name	Rv2383c
Template	1AMU APDB CREDO
Template coverage	19_526
Template Identity(%)	28.0
Model coverage(%)	35.9
Normalized DOPE score	-0.386

Model Number	4
Model name	Rv2383c.4
Template	1PG4 APDB CREDO
Template coverage	12_647
Template Identity(%)	21.0
Model coverage(%)	40.4
Normalized DOPE score	-0.013

Model Number	5
Model name	Rv2383c.7
Template	1XKT APDB CREDO
Template coverage	2220_2501
Template Identity(%)	16.9
Model coverage(%)	17.5
Normalized DOPE score	0.068

Model Number	6
Model name	Rv2383c.3
Template	1L5A APDB CREDO
Template coverage	5_410
Template Identity(%)	15.0
Model coverage(%)	29.4
Normalized DOPE score	0.211

Model Number	7
Model name	Rv2383c.2
Template	1L5A APDB CREDO
Template coverage	1_423
Template Identity(%)	13.9
Model coverage(%)	30.6
Normalized DOPE score	0.3

Structure Models from Chopin

Model Number	1
Profile	e.23.1.1 Click for model details
zscore	36.03
Residue begin	579
Residue end	975

Model Number	2
Profile	c.69.1.22 - 3.40.50.1820 Click for model details
zscore	16.5
Residue begin	1188
Residue end	1413

Model Number	3
Profile	c.43.1.2 Click for model details
zscore	10.6
Residue begin	97
Residue end	284

Model Number	4
Profile	a.28.1.2 - 1.10.1200.10 Click for model details
zscore	8.74
Residue begin	1
Residue end	66

Model Number	5
Profile	a.28.1.2 - 1.10.1200.10 Click for model details
zscore	8.74
Residue begin	1064
Residue end	1129

Binding pockets

STRING

Cytoscape Web will replace the contents of this div with protein-protein interaction network.

Protein interacting with Rv2383c	Gene name	Confidence Score
Rv2386c	mbtI	0.994
Rv2382c	mbtC	0.974
Rv2382c	mbtC	0.974
Rv2384	mbtA	0.962
Rv2384	mbtA	0.962
Rv2381c	mbtD	0.96
Rv2381c	mbtD	0.96
Rv2381c	mbtD	0.96
Rv2377c	mbtH	0.939
Rv1349	irtB	0.935
Rv2378c	mbtG	0.92
Rv1348	irtA	0.906
Rv1348	irtA	0.906
Rv1348	irtA	0.906
Rv1348	irtA	0.906
Rv2380c	mbtE	0.901
Rv2380c	mbtE	0.901
Rv2380c	mbtE	0.901
Rv2380c	mbtE	0.901
Rv2380c	mbtE	0.901

Potential ligand/drug binding sites

Protein Model	Pocket Number	Drug Binding Site	PMIN Score	Pvalue PMIN	PMAX Score	Pvalue PMAX
Rv2383c.4	13	1ya4_CTX_B_2 PDB CREDO	0.779	0.033	0.694	0.000
Rv2383c.4	13	1ya4_CTX_C_3 PDB CREDO	0.755	0.045	0.672	0.000
Rv2383c.4	13	3erd_DES_B_800 PDB CREDO	0.711	0.072	0.661	0.001
Rv2383c.4	13	3bbt_FMM_B_91 PDB CREDO	0.657	0.117	0.633	0.001
Rv2383c.7	1	3bbt_FMM_D_91 PDB CREDO	0.632	0.143	0.632	0.001
Rv2383c.4	13	1mx1_THA_E_5 PDB CREDO	0.640	0.134	0.617	0.002
Rv2383c.4	13	3bbt_FMM_D_91 PDB CREDO	0.727	0.061	0.608	0.002
Rv2383c.7	1	1jg2_ADN_A_500 PDB CREDO	0.622	0.154	0.601	0.002
Rv2383c.4	13	1s9p_DES_D_600 PDB CREDO	0.664	0.111	0.595	0.002
Rv2383c.4	13	3erd_DES_A_600 PDB CREDO	0.635	0.140	0.590	0.003
Rv2383c.7	1	3ria_IVM_C_349 PDB CREDO	0.653	0.121	0.588	0.003
Rv2383c.7	1	3rif_IVM_B_403 PDB CREDO	0.651	0.123	0.586	0.003
Rv2383c.7	1	3rif_IVM_A_402 PDB CREDO	0.651	0.124	0.586	0.003
Rv2383c.7	1	3rif_IVM_D_402 PDB CREDO	0.651	0.124	0.586	0.003
Rv2383c.7	1	3rif_IVM_A_403 PDB CREDO	0.649	0.125	0.584	0.003
Rv2383c.4	13	1mx1_THA_C_3 PDB CREDO	0.651	0.124	0.583	0.003
Rv2383c.7	1	3ri5_IVM_C_350 PDB CREDO	0.647	0.127	0.583	0.003
Rv2383c.7	1	3oht_1N1_B_1000 PDB CREDO	0.622	0.153	0.580	0.003
Rv2383c.4	4	2hw2_RFP_A_1200 PDB CREDO	0.578	0.206	0.578	0.003
Rv2383c.4	4	3oez_STI_B_601 PDB CREDO	0.576	0.208	0.576	0.003
Rv2383c.4	13	1s9p_DES_A_459 PDB CREDO	0.642	0.132	0.576	0.003
Rv2383c.7	14	3grv_ADN_A_300 PDB CREDO	0.630	0.145	0.575	0.003
Rv2383c.4	4	3uvv_T3_A_501 PDB CREDO	0.592	0.188	0.574	0.003
Rv2383c.4	4	1xzx_T3_X_500 PDB CREDO	0.590	0.191	0.572	0.003
Rv2383c.7	1	3spk_TPV_A_100 PDB CREDO	0.589	0.193	0.569	0.004
Rv2383c.4	4	3hec_STI_A_1 PDB CREDO	0.568	0.219	0.568	0.004
Rv2383c.4	4	1bsx_T3_A_1 PDB CREDO	0.604	0.174	0.566	0.004
Rv2383c.4	4	1bsx_T3_B_2 PDB CREDO	0.604	0.174	0.566	0.004
Rv2383c.6	3	3eor_CFV_A_901 PDB CREDO	0.613	0.163	0.566	0.004
Rv2383c.4	13	1g50_EST_A_600 PDB CREDO	0.661	0.114	0.566	0.004
Rv2383c.7	14	1xbb_STI_A_1 PDB CREDO	0.683	0.094	0.566	0.004
Rv2383c.7	1	1jg3_ADN_A_500 PDB CREDO	0.650	0.125	0.564	0.004
Rv2383c.4	13	2yja_EST_B_1550 PDB CREDO	0.658	0.117	0.563	0.004
Rv2383c.4	13	3ols_EST_A_600 PDB CREDO	0.658	0.117	0.563	0.004
Rv2383c.4	4	3gws_T3_X_500 PDB CREDO	0.600	0.179	0.563	0.004
Rv2383c.4	13	3uud_EST_B_600 PDB CREDO	0.656	0.118	0.562	0.004
Rv2383c.7	14	3ads_IMN_B_3 PDB CREDO	0.613	0.164	0.562	0.004
Rv2383c.4	13	3ols_EST_B_600 PDB CREDO	0.656	0.119	0.561	0.004
Rv2383c.4	13	3uud_EST_A_600 PDB CREDO	0.656	0.119	0.561	0.004
Rv2383c.4	4	2oiq_STI_A_1001 PDB CREDO	0.614	0.163	0.559	0.004
Rv2383c.7	1	3bbt_FMM_B_91 PDB CREDO	0.694	0.085	0.559	0.004
Rv2383c.7	1	3k54_1N1_A_1 PDB CREDO	0.642	0.132	0.558	0.004
Rv2383c.4	4	4asd_BAX_A_1500 PDB CREDO	0.629	0.146	0.557	0.004
Rv2383c.4	13	3oht_1N1_B_1000 PDB CREDO	0.621	0.154	0.557	0.004
Rv2383c.7	1	3jwq_VIA_D_901 PDB CREDO	0.557	0.234	0.557	0.004
Rv2383c.4	4	2hyy_STI_B_600 PDB CREDO	0.610	0.167	0.556	0.005
Rv2383c.4	13	2j7y_E3O_A_1454 PDB CREDO	0.578	0.207	0.556	0.005
Rv2383c.4	4	3heg_BAX_A_1 PDB CREDO	0.609	0.168	0.555	0.005
Rv2383c.4	4	3gcs_BAX_A_401 PDB CREDO	0.627	0.148	0.555	0.005
Rv2383c.7	1	2h42_VIA_A_901 PDB CREDO	0.555	0.238	0.555	0.005
Rv2383c.7	1	3rhw_IVM_D_349 PDB CREDO	0.687	0.091	0.553	0.005
Rv2383c.7	1	3ria_IVM_E_349 PDB CREDO	0.687	0.091	0.553	0.005
Rv2383c.7	1	3ria_IVM_E_348 PDB CREDO	0.687	0.091	0.553	0.005
Rv2383c.2	3	1hwk_117_D_3 PDB CREDO	0.570	0.217	0.552	0.005
Rv2383c.7	1	3oht_1N1_A_1000 PDB CREDO	0.660	0.114	0.552	0.005
Rv2383c.7	1	3ri5_IVM_A_349 PDB CREDO	0.686	0.092	0.552	0.005
Rv2383c.7	1	3rhw_IVM_A_348 PDB CREDO	0.685	0.093	0.552	0.005
Rv2383c.7	1	3ria_IVM_A_348 PDB CREDO	0.685	0.093	0.552	0.005
Rv2383c.4	4	1y0x_T44_X_500 PDB CREDO	0.587	0.195	0.552	0.005
Rv2383c.7	1	3rhw_IVM_B_348 PDB CREDO	0.684	0.093	0.551	0.005
Rv2383c.7	1	3rhw_IVM_B_349 PDB CREDO	0.684	0.093	0.551	0.005
Rv2383c.7	1	3rhw_IVM_D_348 PDB CREDO	0.684	0.093	0.551	0.005
Rv2383c.7	1	3rif_IVM_E_402 PDB CREDO	0.684	0.093	0.551	0.005
Rv2383c.7	1	3oct_1N1_A_663 PDB CREDO	0.570	0.217	0.551	0.005
Rv2383c.2	1	2w03_ADN_A_1588 PDB CREDO	0.550	0.243	0.550	0.005
Rv2383c.7	1	3ri5_IVM_B_349 PDB CREDO	0.683	0.095	0.550	0.005
Rv2383c.7	1	3ri5_IVM_D_349 PDB CREDO	0.683	0.095	0.550	0.005
Rv2383c.1	1	1lik_ADN_A_799 PDB CREDO	0.619	0.157	0.550	0.005
Rv2383c.7	1	2fum_MIX_D_3539 PDB CREDO	0.549	0.245	0.549	0.005
Rv2383c.7	1	3ria_IVM_C_350 PDB CREDO	0.682	0.095	0.549	0.005
Rv2383c.4	7	2x9g_LYA_B_1270 PDB CREDO	0.549	0.245	0.549	0.005
Rv2383c.4	13	1mx1_THA_F_6 PDB CREDO	0.616	0.161	0.549	0.005
Rv2383c.4	13	3adx_IMN_B_3 PDB CREDO	0.641	0.134	0.549	0.005
Rv2383c.4	4	1err_RAL_B_600 PDB CREDO	0.566	0.222	0.549	0.005
Rv2383c.4	7	2fum_MIX_D_3539 PDB CREDO	0.567	0.221	0.548	0.005
Rv2383c.4	13	1mx1_THA_D_4 PDB CREDO	0.613	0.163	0.546	0.005
Rv2383c.4	13	3ads_IMN_B_3 PDB CREDO	0.723	0.064	0.546	0.005
Rv2383c.7	14	1r9o_FLP_A_501 PDB CREDO	0.572	0.214	0.546	0.005
Rv2383c.4	4	1err_RAL_A_600 PDB CREDO	0.562	0.227	0.545	0.005
Rv2383c.4	13	3lfa_1N1_A_361 PDB CREDO	0.691	0.087	0.545	0.005
Rv2383c.4	13	1jg2_ADN_A_500 PDB CREDO	0.630	0.145	0.545	0.005
Rv2383c.2	3	1z2b_VLB_C_800 PDB CREDO	0.579	0.205	0.545	0.005
Rv2383c.4	4	1uob_PNN_A_1311 PDB CREDO	0.597	0.182	0.545	0.005
Rv2383c.4	4	2jfa_RAL_A_600 PDB CREDO	0.544	0.252	0.544	0.006
Rv2383c.4	13	3oht_1N1_A_1000 PDB CREDO	0.544	0.253	0.544	0.006
Rv2383c.4	4	2h79_T3_A_1 PDB CREDO	0.599	0.180	0.544	0.006
Rv2383c.4	4	2h77_T3_A_1 PDB CREDO	0.619	0.157	0.543	0.006
Rv2383c.2	3	1hwl_FBI_D_3 PDB CREDO	0.577	0.208	0.543	0.006
Rv2383c.4	4	2jfa_RAL_B_600 PDB CREDO	0.560	0.231	0.542	0.006
Rv2383c.2	3	1hwl_FBI_B_1 PDB CREDO	0.576	0.209	0.542	0.006
Rv2383c.4	7	1kij_NOV_A_400 PDB CREDO	0.560	0.230	0.542	0.006
Rv2383c.4	7	2gqg_1N1_B_502 PDB CREDO	0.560	0.230	0.542	0.006
Rv2383c.2	3	1hwl_FBI_C_4 PDB CREDO	0.575	0.210	0.541	0.006
Rv2383c.4	13	1jg3_ADN_A_500 PDB CREDO	0.560	0.230	0.540	0.006
Rv2383c.7	1	2ito_IRE_A_2020 PDB CREDO	0.671	0.105	0.540	0.006
Rv2383c.2	3	3frq_ERY_B_195 PDB CREDO	0.556	0.236	0.539	0.006
Rv2383c.2	3	1hwl_FBI_A_2 PDB CREDO	0.573	0.213	0.539	0.006
Rv2383c.7	14	3uq6_ADN_B_401 PDB CREDO	0.589	0.192	0.537	0.006
Rv2383c.7	1	1nhz_486_A_800 PDB CREDO	0.555	0.238	0.536	0.006
Rv2383c.7	1	1s9p_DES_A_459 PDB CREDO	0.575	0.211	0.536	0.006
Rv2383c.4	4	1fm6_BRL_X_504 PDB CREDO	0.553	0.240	0.536	0.006
Rv2383c.7	14	3uq6_ADN_A_401 PDB CREDO	0.586	0.196	0.534	0.006
Rv2383c.7	1	1uwh_BAX_A_1723 PDB CREDO	0.670	0.106	0.534	0.006
Rv2383c.7	1	1uwh_BAX_B_1723 PDB CREDO	0.670	0.106	0.534	0.006
Rv2383c.7	1	2xkw_P1B_B_1475 PDB CREDO	0.594	0.187	0.534	0.006
Rv2383c.7	1	1p93_DEX_B_2999 PDB CREDO	0.533	0.268	0.533	0.007
Rv2383c.4	13	3spk_TPV_A_100 PDB CREDO	0.659	0.116	0.533	0.007
Rv2383c.2	3	1hwi_115_D_3 PDB CREDO	0.550	0.245	0.533	0.007
Rv2383c.7	1	1ya3_STR_B_2001 PDB CREDO	0.551	0.243	0.532	0.007
Rv2383c.4	13	3e22_LOC_B_700 PDB CREDO	0.749	0.048	0.532	0.007
Rv2383c.4	4	2pl0_STI_A_200 PDB CREDO	0.583	0.200	0.531	0.007
Rv2383c.7	14	2nnj_225_A_501 PDB CREDO	0.641	0.133	0.531	0.007
Rv2383c.2	3	1hwi_115_B_1 PDB CREDO	0.547	0.248	0.530	0.007
Rv2383c.4	13	3e22_LOC_D_700 PDB CREDO	0.747	0.049	0.530	0.007
Rv2383c.4	13	3h52_486_A_3 PDB CREDO	0.795	0.027	0.530	0.007
Rv2383c.4	7	2x9g_LYA_C_1270 PDB CREDO	0.567	0.221	0.529	0.007
Rv2383c.4	4	1uwh_BAX_A_1723 PDB CREDO	0.563	0.226	0.529	0.007
Rv2383c.4	4	1uwh_BAX_B_1723 PDB CREDO	0.562	0.227	0.529	0.007
Rv2383c.2	3	3frq_ERY_A_195 PDB CREDO	0.596	0.184	0.529	0.007
Rv2383c.4	4	1iep_STI_B_202 PDB CREDO	0.633	0.142	0.528	0.007
Rv2383c.7	1	3kw2_ADN_B_300 PDB CREDO	0.709	0.074	0.528	0.007
Rv2383c.7	14	3clb_TMQ_C_613 PDB CREDO	0.579	0.205	0.528	0.007
Rv2383c.2	1	2xn3_ID8_A_1356 PDB CREDO	0.589	0.193	0.528	0.007
Rv2383c.4	7	2x9g_LYA_D_1270 PDB CREDO	0.565	0.223	0.528	0.007
Rv2383c.4	4	3mss_STI_D_1 PDB CREDO	0.632	0.143	0.528	0.007
Rv2383c.7	14	3adx_IMN_B_3 PDB CREDO	0.653	0.122	0.527	0.007
Rv2383c.4	4	2y6o_1N1_A_1892 PDB CREDO	0.544	0.252	0.527	0.007
Rv2383c.2	3	1hwk_117_C_4 PDB CREDO	0.577	0.207	0.527	0.007
Rv2383c.4	4	1uwj_BAX_B_1723 PDB CREDO	0.596	0.184	0.527	0.007
Rv2383c.4	4	3mss_STI_A_1 PDB CREDO	0.631	0.143	0.527	0.007
Rv2383c.6	3	1e7c_HLT_A_4005 PDB CREDO	0.684	0.094	0.527	0.007
Rv2383c.7	1	1mx1_THA_C_3 PDB CREDO	0.565	0.224	0.527	0.007
Rv2383c.4	4	1iep_STI_A_201 PDB CREDO	0.630	0.144	0.526	0.007
Rv2383c.7	1	1p93_DEX_A_1999 PDB CREDO	0.526	0.279	0.526	0.007
Rv2383c.2	3	1hwk_117_A_2 PDB CREDO	0.576	0.209	0.526	0.007
Rv2383c.4	4	3ms9_STI_B_1 PDB CREDO	0.630	0.145	0.526	0.007
Rv2383c.7	1	2y6o_1N1_A_1892 PDB CREDO	0.600	0.179	0.526	0.007
Rv2383c.4	4	1qkn_RAL_A_600 PDB CREDO	0.560	0.230	0.525	0.007
Rv2383c.4	4	3k5v_STI_B_2 PDB CREDO	0.629	0.146	0.525	0.007
Rv2383c.4	4	3ms9_STI_A_1 PDB CREDO	0.629	0.146	0.525	0.007
Rv2383c.4	4	3pyy_STI_A_3 PDB CREDO	0.629	0.146	0.525	0.007
Rv2383c.4	4	3qt0_486_A_4 PDB CREDO	0.618	0.158	0.525	0.007
Rv2383c.4	4	3gvu_STI_A_1001 PDB CREDO	0.628	0.147	0.525	0.007
Rv2383c.4	4	3mss_STI_C_1 PDB CREDO	0.628	0.147	0.525	0.007
Rv2383c.7	1	3tne_RIT_A_401 PDB CREDO	0.618	0.158	0.524	0.008
Rv2383c.4	4	3mss_STI_B_1 PDB CREDO	0.628	0.147	0.524	0.008
Rv2383c.4	4	3oez_STI_A_601 PDB CREDO	0.627	0.148	0.524	0.008
Rv2383c.7	1	1lhv_NOG_A_301 PDB CREDO	0.598	0.182	0.524	0.008
Rv2383c.7	1	2fum_MIX_A_539 PDB CREDO	0.582	0.201	0.524	0.008
Rv2383c.4	4	3vn2_TLS_A_501 PDB CREDO	0.540	0.258	0.524	0.008
Rv2383c.4	7	3nrr_D16_B_520 PDB CREDO	0.560	0.231	0.523	0.008
Rv2383c.7	14	3hbb_TMQ_A_611 PDB CREDO	0.573	0.213	0.522	0.008
Rv2383c.4	4	2hyy_STI_A_600 PDB CREDO	0.625	0.150	0.522	0.008
Rv2383c.2	3	3tkd_CYZ_A_266 PDB CREDO	0.539	0.260	0.522	0.008
Rv2383c.7	14	1rv7_AB1_B_1001 PDB CREDO	0.620	0.156	0.522	0.008
Rv2383c.7	1	1ya3_STR_A_1001 PDB CREDO	0.540	0.258	0.522	0.008
Rv2383c.2	3	1cil_ETS_A_263 PDB CREDO	0.634	0.141	0.522	0.008
Rv2383c.7	1	3ut5_LOC_D_502 PDB CREDO	0.614	0.162	0.521	0.008
Rv2383c.4	4	3pyy_STI_B_4 PDB CREDO	0.625	0.151	0.521	0.008
Rv2383c.2	1	1r55_097_A_518 PDB CREDO	0.581	0.203	0.521	0.008
Rv2383c.7	14	2bxf_DZP_B_2001 PDB CREDO	0.544	0.252	0.520	0.008
Rv2383c.7	14	2w9h_TOP_A_1160 PDB CREDO	0.544	0.252	0.520	0.008
Rv2383c.7	1	3kw2_ADN_A_300 PDB CREDO	0.622	0.154	0.520	0.008
Rv2383c.7	1	2aax_PDN_A_502 PDB CREDO	0.556	0.236	0.520	0.008
Rv2383c.4	4	2hyy_STI_C_600 PDB CREDO	0.623	0.153	0.520	0.008
Rv2383c.4	4	2hyy_STI_D_600 PDB CREDO	0.623	0.153	0.520	0.008
Rv2383c.4	4	1zgy_BRL_A_503 PDB CREDO	0.592	0.189	0.519	0.008
Rv2383c.7	1	2h42_VIA_B_902 PDB CREDO	0.577	0.208	0.519	0.008
Rv2383c.7	1	2q1v_PDN_A_248 PDB CREDO	0.536	0.264	0.518	0.008
Rv2383c.4	13	2ito_IRE_A_2020 PDB CREDO	0.538	0.261	0.518	0.008
Rv2383c.7	1	2aax_PDN_B_503 PDB CREDO	0.553	0.239	0.517	0.008
Rv2383c.7	1	2ity_IRE_A_2020 PDB CREDO	0.694	0.085	0.517	0.008
Rv2383c.4	4	3cs9_NIL_A_600 PDB CREDO	0.674	0.102	0.517	0.008
Rv2383c.4	13	1mx1_THA_B_2 PDB CREDO	0.629	0.146	0.517	0.008
Rv2383c.7	1	1zgy_BRL_A_503 PDB CREDO	0.535	0.266	0.517	0.008
Rv2383c.7	1	2aa6_STR_A_401 PDB CREDO	0.553	0.240	0.517	0.008
Rv2383c.7	1	2gqg_1N1_A_501 PDB CREDO	0.574	0.211	0.517	0.008
Rv2383c.4	7	2x9g_LYA_A_1270 PDB CREDO	0.569	0.217	0.516	0.009
Rv2383c.6	4	1pwy_AC2_E_290 PDB CREDO	0.516	0.293	0.516	0.009
Rv2383c.7	1	1jg3_ADN_B_550 PDB CREDO	0.666	0.109	0.516	0.009
Rv2383c.7	14	3hbb_TMQ_C_613 PDB CREDO	0.539	0.259	0.516	0.009
Rv2383c.7	1	1lhu_EST_A_301 PDB CREDO	0.553	0.240	0.515	0.009
Rv2383c.7	1	2aa6_STR_B_402 PDB CREDO	0.551	0.242	0.515	0.009
Rv2383c.7	14	2bxf_DZP_A_2001 PDB CREDO	0.539	0.259	0.515	0.009
Rv2383c.4	4	1uwj_BAX_A_1723 PDB CREDO	0.634	0.141	0.514	0.009
Rv2383c.4	13	1gs4_ZK5_A_1918 PDB CREDO	0.553	0.239	0.514	0.009
Rv2383c.4	7	3tne_RIT_A_401 PDB CREDO	0.585	0.197	0.514	0.009
Rv2383c.6	3	3b9m_SAL_A_1100 PDB CREDO	0.557	0.235	0.514	0.009
Rv2383c.7	1	3ri5_IVM_E_349 PDB CREDO	0.689	0.089	0.514	0.009
Rv2383c.4	35	2y7j_B49_C_1294 PDB CREDO	0.668	0.107	0.513	0.009
Rv2383c.7	1	3sxr_1N1_A_1 PDB CREDO	0.689	0.090	0.513	0.009
Rv2383c.4	7	1a4l_DCF_D_1853 PDB CREDO	0.590	0.192	0.513	0.009
Rv2383c.4	7	1a4l_DCF_A_353 PDB CREDO	0.589	0.192	0.512	0.009
Rv2383c.4	7	1cil_ETS_A_263 PDB CREDO	0.530	0.273	0.512	0.009
Rv2383c.7	1	3adx_IMN_B_3 PDB CREDO	0.715	0.070	0.512	0.009
Rv2383c.3	3	3sm2_478_A_126 PDB CREDO	0.851	0.010	0.512	0.009
Rv2383c.4	7	3ln1_CEL_D_682 PDB CREDO	0.530	0.273	0.512	0.009
Rv2383c.6	4	1muo_ADN_A_1 PDB CREDO	0.547	0.248	0.512	0.009
Rv2383c.7	1	3h0a_9RA_A_500 PDB CREDO	0.511	0.301	0.511	0.009
Rv2383c.4	4	3ln1_CEL_A_682 PDB CREDO	0.545	0.251	0.511	0.009
Rv2383c.4	4	3ln1_CEL_B_682 PDB CREDO	0.545	0.251	0.511	0.009
Rv2383c.4	4	1kij_NOV_A_400 PDB CREDO	0.601	0.177	0.510	0.009
Rv2383c.7	1	3h52_486_C_4 PDB CREDO	0.567	0.221	0.510	0.009
Rv2383c.7	14	3clb_TMQ_B_612 PDB CREDO	0.534	0.267	0.510	0.009
Rv2383c.2	3	1hwi_115_A_2 PDB CREDO	0.580	0.204	0.510	0.009
Rv2383c.4	13	2jfa_RAL_B_600 PDB CREDO	0.741	0.053	0.510	0.009
Rv2383c.6	3	1f86_T44_B_528 PDB CREDO	0.605	0.173	0.510	0.009
Rv2383c.7	14	3kw2_ADN_B_300 PDB CREDO	0.657	0.118	0.510	0.009
Rv2383c.4	7	3oct_1N1_A_663 PDB CREDO	0.546	0.250	0.510	0.009
Rv2383c.4	7	3apw_DP0_A_190 PDB CREDO	0.527	0.278	0.509	0.009
Rv2383c.7	1	3so9_017_A_100 PDB CREDO	0.638	0.136	0.509	0.009
Rv2383c.7	14	3ug2_IRE_A_1 PDB CREDO	0.615	0.162	0.509	0.009
Rv2383c.7	14	2ity_IRE_A_2020 PDB CREDO	0.656	0.119	0.509	0.009
Rv2383c.4	4	2xkw_P1B_B_1475 PDB CREDO	0.666	0.109	0.509	0.010
Rv2383c.4	4	3ln1_CEL_C_682 PDB CREDO	0.543	0.254	0.509	0.010
Rv2383c.7	14	1m17_AQ4_A_999 PDB CREDO	0.604	0.174	0.509	0.010
Rv2383c.6	4	1nr6_DIF_A_501 PDB CREDO	0.613	0.164	0.508	0.010
Rv2383c.4	7	1a4l_DCF_C_1353 PDB CREDO	0.584	0.199	0.508	0.010
Rv2383c.4	4	3v5w_8PR_A_701 PDB CREDO	0.541	0.257	0.507	0.010
Rv2383c.4	7	2fum_MIX_A_539 PDB CREDO	0.583	0.200	0.507	0.010
Rv2383c.4	13	1s9p_DES_C_500 PDB CREDO	0.569	0.218	0.507	0.010
Rv2383c.4	13	1err_RAL_A_600 PDB CREDO	0.737	0.055	0.507	0.010
Rv2383c.4	13	3rif_IVM_A_403 PDB CREDO	0.546	0.250	0.507	0.010
Rv2383c.4	7	3ln1_CEL_A_682 PDB CREDO	0.542	0.256	0.507	0.010
Rv2383c.4	7	3ln1_CEL_C_682 PDB CREDO	0.542	0.256	0.507	0.010
Rv2383c.7	14	1uay_ADN_A_1001 PDB CREDO	0.531	0.272	0.507	0.010
Rv2383c.7	14	3r9c_ECL_A_451 PDB CREDO	0.677	0.099	0.507	0.010
Rv2383c.3	3	1ya4_CTX_A_1 PDB CREDO	0.783	0.032	0.507	0.010
Rv2383c.7	1	3jwq_VIA_B_901 PDB CREDO	0.563	0.226	0.507	0.010
Rv2383c.7	14	3ri5_IVM_E_349 PDB CREDO	0.653	0.122	0.507	0.010
Rv2383c.4	13	1s9p_DES_B_459 PDB CREDO	0.569	0.219	0.507	0.010
Rv2383c.4	7	1qkn_RAL_A_600 PDB CREDO	0.541	0.256	0.507	0.010
Rv2383c.4	13	2xkw_P1B_B_1475 PDB CREDO	0.545	0.251	0.506	0.010
Rv2383c.4	4	1opj_STI_A_3 PDB CREDO	0.660	0.115	0.506	0.010
Rv2383c.4	7	3tne_RIT_B_401 PDB CREDO	0.577	0.208	0.506	0.010
Rv2383c.7	1	3e22_LOC_D_700 PDB CREDO	0.597	0.183	0.506	0.010
Rv2383c.2	1	2jih_097_A_1001 PDB CREDO	0.562	0.228	0.506	0.010
Rv2383c.7	1	1sa1_POD_D_701 PDB CREDO	0.654	0.121	0.506	0.010
Rv2383c.4	7	2h77_T3_A_1 PDB CREDO	0.506	0.310	0.506	0.010
Rv2383c.2	3	1hwk_117_B_1 PDB CREDO	0.587	0.195	0.506	0.010
Rv2383c.7	1	3e22_LOC_B_700 PDB CREDO	0.596	0.184	0.505	0.010
Rv2383c.2	3	3tkd_CYZ_B_267 PDB CREDO	0.521	0.286	0.505	0.010
Rv2383c.4	13	3ogp_017_A_200 PDB CREDO	0.781	0.033	0.505	0.010
Rv2383c.4	13	1n49_RIT_D_401 PDB CREDO	0.853	0.010	0.505	0.010
Rv2383c.4	7	3ln1_CEL_B_682 PDB CREDO	0.540	0.259	0.505	0.010
Rv2383c.7	1	2h42_VIA_C_903 PDB CREDO	0.561	0.229	0.505	0.010
Rv2383c.1	1	3ijx_HCZ_D_800 PDB CREDO	0.602	0.176	0.505	0.010
Rv2383c.4	4	3k5v_STI_A_2 PDB CREDO	0.640	0.135	0.505	0.010
Rv2383c.4	7	1a4l_DCF_B_853 PDB CREDO	0.580	0.204	0.505	0.010
Rv2383c.7	14	2itz_IRE_A_2021 PDB CREDO	0.624	0.151	0.504	0.010
Rv2383c.7	14	3clb_TMQ_A_611 PDB CREDO	0.527	0.277	0.504	0.010
Rv2383c.2	3	1lhv_NOG_A_301 PDB CREDO	0.537	0.262	0.504	0.010
Rv2383c.4	13	1err_RAL_B_600 PDB CREDO	0.733	0.058	0.504	0.010
Rv2383c.2	1	2fn1_SAL_B_503 PDB CREDO	0.504	0.313	0.504	0.010
Rv2383c.4	7	1etr_MIT_H_1 PDB CREDO	0.538	0.261	0.503	0.010
Rv2383c.4	7	3k2h_LYA_B_514 PDB CREDO	0.558	0.233	0.503	0.010
Rv2383c.6	3	1f86_T44_A_428 PDB CREDO	0.654	0.121	0.503	0.010
Rv2383c.4	4	1opj_STI_B_4 PDB CREDO	0.656	0.119	0.503	0.010
Rv2383c.7	14	3jw5_TOP_A_208 PDB CREDO	0.672	0.104	0.503	0.010
Rv2383c.7	1	2aa5_STR_B_302 PDB CREDO	0.538	0.261	0.503	0.010
Rv2383c.7	14	2w9s_TOP_F_1159 PDB CREDO	0.502	0.315	0.502	0.011
Rv2383c.7	14	1mx1_THA_A_1 PDB CREDO	0.572	0.215	0.502	0.011
Rv2383c.7	1	1p93_DEX_C_3999 PDB CREDO	0.554	0.238	0.501	0.011
Rv2383c.7	1	1uwj_BAX_B_1723 PDB CREDO	0.667	0.108	0.501	0.011
Rv2383c.4	4	3cs9_NIL_B_600 PDB CREDO	0.671	0.105	0.501	0.011
Rv2383c.7	1	1fm6_BRL_D_503 PDB CREDO	0.537	0.263	0.501	0.011
Rv2383c.7	1	3sxr_1N1_B_2 PDB CREDO	0.700	0.081	0.501	0.011
Rv2383c.3	3	3ndu_ROC_A_101 PDB CREDO	0.521	0.286	0.501	0.011
Rv2383c.4	4	3b0w_DGX_B_1 PDB CREDO	0.635	0.140	0.501	0.011
Rv2383c.2	1	1m2w_MTL_A_5600 PDB CREDO	0.501	0.317	0.501	0.011
Rv2383c.7	1	2aa5_STR_A_301 PDB CREDO	0.535	0.265	0.501	0.011
Rv2383c.7	1	3d91_REM_A_350 PDB CREDO	0.666	0.109	0.500	0.011

Similarity to known drug target from sensitive sequence analysis

No drug targets

List of small molecules tested from TIBLE

Data not available

Off-target activity - ligand based from TIBLE

Data not available

Small molecules involved in protein-protein complex from TIMBAL .Proteins similar to Mtb based on sequence analysis.

Data not available

STITCH interactions

No high confidence interactions