SInCRe - Rv2380c

Tuberculist information

Gene name	mbtE
Protein function	Peptide synthetase MbtE (peptide synthase)
Functional category(tuberculist)	lipid metabolism
Gene location(kb)	2662.07
Molecular mass(da)	183282
External sites	TB Database TubercuList WebTB

Protein sequence

Number of amino acids : 1682

	  		  	1    MWFVQMADPSGALLNICVSYRITGDIDLARLRDAVNAVARRHRILRTTYPVGDDGVAQPT   60
			  	61   VHADLRPGWTQYDLTDLSQRAQRLRLEVLAQREFCAPFELSRDAPLRITVVRTAADEHVL  120
			  	121  LLVAHHIAWDDGSWRVFFTDLTQAYSRADLGADLGPEHRPSAASGPDTTEADLNYWRAIM  180
			  	181  ADPPEPLELPGPAGTCVPTSWRAARATLRLPADTAARVATMAKNTGCTPYMVLLAAFGAL  240
			  	241  VHRYTHSDDFLVAAPVLNRGAGTEDAIGYFGNTVAMRLRPQSAMSFRELLTATRDIASGA  300
			  	301  FAHQRINLDRVVRELNPDRRHGAERMTRVSFGFREPDGGGFNPPGIECERYDLRSNITQL  360
			  	361  PLGFMVEFDRAGVLVEAEHLVEILEPALAKQMLRHFGVLLDNALAAPDNTLSGLALMDER  420
			  	421  DAARLREVSRGERFDTPVKTLVDLVNEQTTRTPDATAVVYEGQHFTYHDLNEASNRLGHW  480
			  	481  LIEQGIGSEDRVAVLLDKSPDLIVTALGVVKSGAVYVPVDPSYPQDRLDFILADCDAKLV  540
			  	541  LRTPVRELAGYRSDDPTDADRIRPLRPDNTAYLIYTSGTTGLPKGVAVPHRPVAEYFVWF  600
			  	601  KGEYDVDDTDRLLQVASPSFDVSIAEIFGTLACGARMVIPRPGGLTDIGYLTALLRDEGI  660
			  	661  TAMHFVPSLLGLFLSLPGVSQWRTLQRVPIGGEPLPGEVADKFHATFDALLHNFYGPTET  720
			  	721  VINASRFKVVGPQGTRIVPIGRPKINTTMHLLDDSLQPVPTGVIGEIYIGGTHVAYGYHR  780
			  	781  RAGLTAERFVADPFNPGSRMYRSGDLARRNADGDIEFVGRADEQVKIRGFRIELGDVAAA  840
			  	841  IAVDPTVGQAVVVVSDLPRLGKSLVGYVTPAAGGDGPADVGVDLDRIRARVAAALPEYML  900
			  	901  PAAYVVLDEIPITAHGKIDRAALPEPQIASDTEFRAPQTATERRLAQLFGELLGRDRVGA  960
			  	961  DDSFFDLGGHSLLATKLVAAVRNAFGVDVGVREIFEFATVTALAGHIDTLDSDSARPRLT 1020
			  	1021 RVDHDGPVRLSSSQMRSWFNYRFDGPNAVNNIPFAAALHGPCDTNAFAAAITDVVARHEI 1080
			  	1081 LRTVYREIGGVPHQIIQPPAEVPVRCAAGSDAAWLRAELNNERGYVFDLETDWPIRAALL 1140
			  	1141 STPEQTVLSLVVHHIAGDHWSAGVLFTDLLTAYRARSTGQRPSWAPLPVQYADYSVWQSA 1200
			  	1201 LLDDGAGIVGPQRDYWIRQLGGLAGETGLRPDFPRPALLSGAGDAVEFRLGAAIRDKLAA 1260
			  	1261 VSRDLGVTEFMLLQAAVAVVLHKAGGGVDVPIGAPVAGRSEANLDQLIGFFINIVVLRND 1320
			  	1321 LRGNPTLREVLQRTRQMALAAYAHQDLPFDQVVEAVNPQRSLSRNPLFDIVVHVREQMPQ 1380
			  	1381 DHVIDTGPDGDTTLRVLEPTFDAAQADLSVNFFACGDEYRGHVIYRTELYERATAQRFAD 1440
			  	1441 WLVRVVEAFADRPDQPLREVEMVSAQARRRILDRSNAGAGTARVYLLDDALKPVPVGVVG 1500
			  	1501 DVYYGGGPAVGARLARPSETATRFVADPFAAQPGSRLYRNGERGVWKADGQLELLAEIER 1560
			  	1561 LPTAQAAPVPAEPADTETERALAAILADVLEVGEVGRYDDFFNLGGDSILATQVAARARD 1620
			  	1621 GGIPLTARMVFEHPVLCELAAAVDAKPHVEAEPDDKHHAPMSTSGLSPDELSALTASWDQ 1680
			  	1681 WP

Known structures in the PDB

No Known structures

Profile-based domain assignment

Structural/Functional domain family	Pfam acc.no./SCOP ID	Domain Region
Condensation	PF00668	1-281
HxxPF_rpt	PF13745	302-392
AMP-binding	PF00501	445-828
AMP-binding_C	PF13193	836-917
PP-binding	PF00550	943-1007
Condensation	PF00668	1024-1322
HxxPF_rpt	PF13745	1343-1438
AMP-binding	PF00501	1473-1556
PP-binding	PF00550	1580-1643

Mtb Structural Proteome models

Model Number	1
Model name	Rv2380c.5
Template	1DNY APDB CREDO
Template coverage	10_83
Template Identity(%)	36.5
Model coverage(%)	4.3
Normalized DOPE score	-1.074

Model Number	2
Model name	Rv2380c
Template	1AMU APDB CREDO
Template coverage	39_528
Template Identity(%)	34.6
Model coverage(%)	29.1
Normalized DOPE score	-0.68

Model Number	3
Model name	Rv2380c.7
Template	1DNY APDB CREDO
Template coverage	10_81
Template Identity(%)	35.2
Model coverage(%)	4.2
Normalized DOPE score	-0.554

Model Number	4
Model name	Rv2380c.3
Template	1PG4 APDB CREDO
Template coverage	11_646
Template Identity(%)	19.2
Model coverage(%)	34.2
Normalized DOPE score	-0.148

Model Number	5
Model name	Rv2380c.1
Template	1L5A APDB CREDO
Template coverage	8_424
Template Identity(%)	15.6
Model coverage(%)	25.1
Normalized DOPE score	0.034

Model Number	6
Model name	Rv2380c.6
Template	1L5A APDB CREDO
Template coverage	1_423
Template Identity(%)	15.6
Model coverage(%)	26.0
Normalized DOPE score	0.043

Model Number	7
Model name	Rv2380c.2
Template	1L5A APDB CREDO
Template coverage	9_423
Template Identity(%)	16.4
Model coverage(%)	25.4
Normalized DOPE score	0.327

Structure Models from Chopin

Model Number	1
Profile	e.23.1.1 Click for model details
zscore	25.46
Residue begin	466
Residue end	852

Model Number	2
Profile	e.23.1.1 Click for model details
zscore	25.46
Residue begin	1473
Residue end	1859

Model Number	3
Profile	c.43.1.2 Click for model details
zscore	16.57
Residue begin	1
Residue end	183

Model Number	4
Profile	c.43.1.2 Click for model details
zscore	16.57
Residue begin	1024
Residue end	1206

Model Number	5
Profile	a.28.1.2 - 1.10.1200.10 Click for model details
zscore	13.25
Residue begin	1
Residue end	65

Model Number	6
Profile	a.28.1.2 - 1.10.1200.10 Click for model details
zscore	13.25
Residue begin	943
Residue end	1007

Model Number	7
Profile	a.28.1.2 - 1.10.1200.10 Click for model details
zscore	13.25
Residue begin	1580
Residue end	1644

Binding pockets

STRING

Cytoscape Web will replace the contents of this div with protein-protein interaction network.

Protein interacting with Rv2380c	Gene name	Confidence Score
Rv2377c	mbtH	0.998
Rv2379c	mbtF	0.97
Rv2379c	mbtF	0.97
Rv2379c	mbtF	0.97
Rv2379c	mbtF	0.97
Rv2378c	mbtG	0.951
Rv2382c	mbtC	0.941
Rv2382c	mbtC	0.941
Rv2947c	pks15	0.912
Rv2947c	pks15	0.912
Rv2947c	pks15	0.912
Rv2928	tesA	0.91
Rv2383c	mbtB	0.901
Rv2383c	mbtB	0.901
Rv2383c	mbtB	0.901
Rv2383c	mbtB	0.901
Rv2383c	mbtB	0.901
Rv2383c	mbtB	0.901

Potential ligand/drug binding sites

Protein Model	Pocket Number	Drug Binding Site	PMIN Score	Pvalue PMIN	PMAX Score	Pvalue PMAX
Rv2380c.2	4	2xkw_P1B_A_1478 PDB CREDO	0.683	0.095	0.633	0.001
Rv2380c.3	3	3rem_SAL_A_301 PDB CREDO	0.658	0.117	0.626	0.001
Rv2380c.3	3	3rem_SAL_B_301 PDB CREDO	0.654	0.121	0.622	0.001
Rv2380c.1	1	2uxo_TAC_B_1211 PDB CREDO	0.642	0.133	0.616	0.002
Rv2380c.3	11	1yi4_ADN_A_306 PDB CREDO	0.649	0.126	0.615	0.002
Rv2380c.2	4	1xkk_FMM_A_91 PDB CREDO	0.678	0.099	0.613	0.002
Rv2380c.3	5	2x9g_LYA_C_1270 PDB CREDO	0.605	0.173	0.605	0.002
Rv2380c.3	5	2x9g_LYA_D_1270 PDB CREDO	0.605	0.173	0.605	0.002
Rv2380c.3	5	3nrr_D16_B_520 PDB CREDO	0.596	0.184	0.596	0.002
Rv2380c.3	3	3rf4_FUN_B_202 PDB CREDO	0.626	0.150	0.595	0.002
Rv2380c.3	3	3rf4_FUN_A_201 PDB CREDO	0.622	0.154	0.591	0.002
Rv2380c.3	3	3rf4_FUN_C_203 PDB CREDO	0.622	0.154	0.591	0.002
Rv2380c.3	3	1h9z_RWF_A_3001 PDB CREDO	0.619	0.157	0.589	0.003
Rv2380c.3	3	2bxe_1FL_A_2003 PDB CREDO	0.619	0.157	0.589	0.003
Rv2380c.2	4	3bjw_SVR_B_501 PDB CREDO	0.651	0.124	0.588	0.003
Rv2380c.3	3	2bxe_1FL_B_2003 PDB CREDO	0.618	0.158	0.588	0.003
Rv2380c.1	1	3kw2_ADN_B_300 PDB CREDO	0.584	0.199	0.584	0.003
Rv2380c.2	4	3bjw_SVR_H_504 PDB CREDO	0.644	0.130	0.583	0.003
Rv2380c.3	29	3k2h_LYA_A_514 PDB CREDO	0.581	0.202	0.581	0.003
Rv2380c.3	8	4eyb_0WO_A_303 PDB CREDO	0.602	0.177	0.581	0.003
Rv2380c.1	1	1g50_EST_A_600 PDB CREDO	0.604	0.174	0.580	0.003
Rv2380c.1	1	1s9p_DES_C_500 PDB CREDO	0.580	0.203	0.580	0.003
Rv2380c.1	1	1s9p_DES_B_459 PDB CREDO	0.579	0.205	0.579	0.003
Rv2380c.1	1	3ols_EST_A_600 PDB CREDO	0.602	0.177	0.578	0.003
Rv2380c.1	1	3ols_EST_B_600 PDB CREDO	0.602	0.177	0.578	0.003
Rv2380c.2	4	3bjw_SVR_F_502 PDB CREDO	0.639	0.136	0.578	0.003
Rv2380c.2	4	3bjw_SVR_E_503 PDB CREDO	0.691	0.088	0.577	0.003
Rv2380c.3	5	3ln1_CEL_D_682 PDB CREDO	0.597	0.182	0.577	0.003
Rv2380c.1	1	2yja_EST_B_1550 PDB CREDO	0.599	0.180	0.576	0.003
Rv2380c.2	4	1t46_STI_A_3 PDB CREDO	0.670	0.105	0.575	0.003
Rv2380c.3	5	3ads_IMN_A_2 PDB CREDO	0.573	0.213	0.573	0.003
Rv2380c.3	5	2x9g_LYA_B_1270 PDB CREDO	0.613	0.164	0.572	0.003
Rv2380c.1	1	3sxr_1N1_A_1 PDB CREDO	0.572	0.214	0.572	0.003
Rv2380c.1	1	3uud_EST_A_600 PDB CREDO	0.595	0.185	0.572	0.003
Rv2380c.1	1	3uud_EST_B_600 PDB CREDO	0.593	0.187	0.570	0.004
Rv2380c.3	5	3oct_1N1_A_663 PDB CREDO	0.567	0.220	0.567	0.004
Rv2380c.1	1	3g5d_1N1_B_1 PDB CREDO	0.587	0.194	0.565	0.004
Rv2380c.2	4	3sm2_478_A_126 PDB CREDO	0.593	0.187	0.564	0.004
Rv2380c.3	8	4eyb_0WO_B_301 PDB CREDO	0.628	0.148	0.564	0.004
Rv2380c.2	4	3gp0_NIL_A_1 PDB CREDO	0.638	0.136	0.562	0.004
Rv2380c.2	4	3cs9_NIL_C_600 PDB CREDO	0.655	0.120	0.562	0.004
Rv2380c.1	1	3qlg_1N1_A_601 PDB CREDO	0.581	0.202	0.559	0.004
Rv2380c.3	11	2y7j_B49_A_1294 PDB CREDO	0.713	0.071	0.558	0.004
Rv2380c.1	1	1ie4_T44_A_128 PDB CREDO	0.605	0.174	0.558	0.004
Rv2380c.1	1	2zva_1N1_A_513 PDB CREDO	0.558	0.233	0.558	0.004
Rv2380c.1	1	3sxr_1N1_B_2 PDB CREDO	0.579	0.205	0.556	0.005
Rv2380c.1	1	3adx_IMN_B_3 PDB CREDO	0.578	0.206	0.555	0.005
Rv2380c.1	1	3g5d_1N1_A_1 PDB CREDO	0.577	0.207	0.555	0.005
Rv2380c.3	38	1xbb_STI_A_1 PDB CREDO	0.614	0.163	0.555	0.005
Rv2380c.1	1	3qlg_1N1_B_601 PDB CREDO	0.576	0.208	0.554	0.005
Rv2380c.1	1	2cbr_A80_A_201 PDB CREDO	0.622	0.154	0.554	0.005
Rv2380c.1	1	3bbt_FMM_B_91 PDB CREDO	0.598	0.181	0.554	0.005
Rv2380c.3	29	3kw2_ADN_A_300 PDB CREDO	0.597	0.182	0.553	0.005
Rv2380c.3	29	1z9y_FUN_A_500 PDB CREDO	0.575	0.211	0.553	0.005
Rv2380c.3	11	1pg2_ADN_A_552 PDB CREDO	0.673	0.103	0.553	0.005
Rv2380c.3	5	3adx_IMN_A_2 PDB CREDO	0.592	0.188	0.552	0.005
Rv2380c.3	5	3k2h_LYA_B_514 PDB CREDO	0.571	0.215	0.552	0.005
Rv2380c.3	5	3jwq_VIA_B_901 PDB CREDO	0.592	0.189	0.551	0.005
Rv2380c.1	1	2w8y_NDR_B_1000 PDB CREDO	0.551	0.243	0.551	0.005
Rv2380c.3	29	3kw2_ADN_B_300 PDB CREDO	0.573	0.213	0.551	0.005
Rv2380c.3	5	2h77_T3_A_1 PDB CREDO	0.589	0.192	0.550	0.005
Rv2380c.1	1	1s9p_DES_A_459 PDB CREDO	0.689	0.090	0.550	0.005
Rv2380c.3	11	2y7j_B49_C_1294 PDB CREDO	0.609	0.169	0.550	0.005
Rv2380c.3	5	2x9g_LYA_A_1270 PDB CREDO	0.650	0.125	0.550	0.005
Rv2380c.3	5	1lhu_EST_A_301 PDB CREDO	0.569	0.218	0.549	0.005
Rv2380c.2	4	3b0w_DGX_B_1 PDB CREDO	0.714	0.071	0.549	0.005
Rv2380c.2	4	3cs9_NIL_D_600 PDB CREDO	0.640	0.135	0.549	0.005
Rv2380c.3	34	1xos_VIA_A_1 PDB CREDO	0.548	0.247	0.548	0.005
Rv2380c.2	4	1uwj_BAX_A_1723 PDB CREDO	0.732	0.059	0.547	0.005
Rv2380c.3	5	4a97_ZPC_J_1318 PDB CREDO	0.587	0.195	0.547	0.005
Rv2380c.3	29	3fuu_ADN_A_0 PDB CREDO	0.546	0.250	0.546	0.005
Rv2380c.1	1	2xn5_FUN_A_1356 PDB CREDO	0.568	0.219	0.546	0.005
Rv2380c.3	5	1fm6_BRL_D_503 PDB CREDO	0.565	0.223	0.546	0.005
Rv2380c.3	11	2y7j_B49_D_1294 PDB CREDO	0.729	0.060	0.545	0.005
Rv2380c.3	34	1xot_VDN_A_101 PDB CREDO	0.545	0.251	0.545	0.005
Rv2380c.1	1	2ity_IRE_A_2020 PDB CREDO	0.544	0.252	0.544	0.005
Rv2380c.1	1	2xn7_T44_A_1355 PDB CREDO	0.567	0.221	0.544	0.005
Rv2380c.1	1	3r9c_ECL_A_452 PDB CREDO	0.615	0.161	0.544	0.005
Rv2380c.3	5	3ln1_CEL_A_682 PDB CREDO	0.623	0.153	0.544	0.006
Rv2380c.2	4	3cs9_NIL_B_600 PDB CREDO	0.669	0.107	0.544	0.006
Rv2380c.3	3	3hgx_SAL_B_104 PDB CREDO	0.670	0.106	0.544	0.006
Rv2380c.3	11	1xbb_STI_A_1 PDB CREDO	0.602	0.177	0.544	0.006
Rv2380c.3	38	2nnj_225_A_501 PDB CREDO	0.602	0.177	0.544	0.006
Rv2380c.1	1	1ie4_T44_B_328 PDB CREDO	0.565	0.223	0.544	0.006
Rv2380c.3	29	1a27_EST_A_350 PDB CREDO	0.544	0.253	0.544	0.006
Rv2380c.1	1	3cs8_BRL_A_503 PDB CREDO	0.544	0.253	0.544	0.006
Rv2380c.3	29	2xpw_OTC_A_222 PDB CREDO	0.543	0.254	0.543	0.006
Rv2380c.3	5	1kij_NOV_A_400 PDB CREDO	0.562	0.227	0.543	0.006
Rv2380c.2	4	3cs9_NIL_A_600 PDB CREDO	0.686	0.092	0.543	0.006
Rv2380c.1	1	1mx1_THA_F_6 PDB CREDO	0.543	0.254	0.543	0.006
Rv2380c.3	5	1s9p_DES_A_459 PDB CREDO	0.562	0.227	0.543	0.006
Rv2380c.3	5	3ln1_CEL_B_682 PDB CREDO	0.621	0.155	0.543	0.006
Rv2380c.1	1	3oht_1N1_A_1000 PDB CREDO	0.609	0.169	0.542	0.006
Rv2380c.3	34	1fdu_EST_B_354 PDB CREDO	0.566	0.222	0.542	0.006
Rv2380c.3	5	2cbr_A80_A_201 PDB CREDO	0.626	0.149	0.542	0.006
Rv2380c.3	5	3ln1_CEL_C_682 PDB CREDO	0.620	0.156	0.542	0.006
Rv2380c.3	3	3ret_SAL_B_201 PDB CREDO	0.667	0.109	0.541	0.006
Rv2380c.3	29	2vke_TAC_A_222 PDB CREDO	0.541	0.257	0.541	0.006
Rv2380c.3	29	3sxr_1N1_A_1 PDB CREDO	0.562	0.227	0.541	0.006
Rv2380c.3	5	3jwq_VIA_D_901 PDB CREDO	0.560	0.231	0.541	0.006
Rv2380c.3	3	2bxq_P1Z_A_2002 PDB CREDO	0.568	0.219	0.540	0.006
Rv2380c.3	29	2xn5_FUN_A_1356 PDB CREDO	0.584	0.198	0.540	0.006
Rv2380c.3	5	4eb6_VLB_C_503 PDB CREDO	0.579	0.205	0.540	0.006
Rv2380c.3	29	2trt_TAC_A_222 PDB CREDO	0.584	0.199	0.539	0.006
Rv2380c.3	3	3ret_SAL_A_201 PDB CREDO	0.664	0.111	0.539	0.006
Rv2380c.3	5	2h42_VIA_C_903 PDB CREDO	0.579	0.206	0.539	0.006
Rv2380c.3	8	3k2h_LYA_B_514 PDB CREDO	0.558	0.233	0.539	0.006
Rv2380c.3	29	1uof_PNN_A_1312 PDB CREDO	0.583	0.200	0.538	0.006
Rv2380c.3	38	3jw5_TOP_A_208 PDB CREDO	0.538	0.260	0.538	0.006
Rv2380c.3	38	3jw5_TOP_B_208 PDB CREDO	0.538	0.260	0.538	0.006
Rv2380c.3	29	3bbt_FMM_B_91 PDB CREDO	0.559	0.232	0.538	0.006
Rv2380c.3	11	1gwr_EST_A_600 PDB CREDO	0.686	0.092	0.537	0.006
Rv2380c.3	29	3sxr_1N1_B_2 PDB CREDO	0.581	0.202	0.537	0.006
Rv2380c.3	5	3apx_Z80_A_190 PDB CREDO	0.597	0.182	0.537	0.006
Rv2380c.3	38	3ug2_IRE_A_1 PDB CREDO	0.594	0.186	0.537	0.006
Rv2380c.3	5	3apv_TP0_A_190 PDB CREDO	0.597	0.183	0.536	0.006
Rv2380c.1	1	3kw2_ADN_A_300 PDB CREDO	0.602	0.177	0.536	0.006
Rv2380c.3	11	1gwr_EST_B_600 PDB CREDO	0.684	0.093	0.536	0.006
Rv2380c.3	38	2w9g_TOP_A_1159 PDB CREDO	0.596	0.184	0.536	0.006
Rv2380c.1	1	1mx1_THA_D_4 PDB CREDO	0.536	0.264	0.536	0.006
Rv2380c.3	5	2gqg_1N1_A_501 PDB CREDO	0.575	0.211	0.535	0.006
Rv2380c.3	3	1hk3_T44_A_3001 PDB CREDO	0.592	0.188	0.535	0.006
Rv2380c.3	5	3h0a_9RA_A_500 PDB CREDO	0.554	0.238	0.535	0.006
Rv2380c.1	1	2xn6_T44_A_1370 PDB CREDO	0.557	0.235	0.535	0.006
Rv2380c.3	29	2o7o_DXT_A_222 PDB CREDO	0.579	0.205	0.535	0.006
Rv2380c.3	34	1fds_EST_A_350 PDB CREDO	0.535	0.266	0.535	0.006
Rv2380c.3	34	3vrj_1KX_A_301 PDB CREDO	0.558	0.232	0.535	0.006
Rv2380c.3	5	2prg_BRL_B_2 PDB CREDO	0.553	0.239	0.534	0.006
Rv2380c.1	1	3k2h_LYA_A_514 PDB CREDO	0.555	0.237	0.534	0.006
Rv2380c.3	29	2cbr_A80_A_201 PDB CREDO	0.576	0.209	0.534	0.006
Rv2380c.3	29	3jwq_VIA_B_901 PDB CREDO	0.620	0.156	0.534	0.006
Rv2380c.1	1	3o1c_ADN_A_127 PDB CREDO	0.621	0.155	0.533	0.007
Rv2380c.3	6	1d4f_ADN_C_603 PDB CREDO	0.553	0.240	0.533	0.007
Rv2380c.3	5	3qt0_486_A_4 PDB CREDO	0.552	0.242	0.533	0.007
Rv2380c.3	8	1kij_NOV_A_400 PDB CREDO	0.552	0.242	0.533	0.007
Rv2380c.3	3	3hgx_SAL_A_102 PDB CREDO	0.656	0.118	0.533	0.007
Rv2380c.3	11	1pcg_EST_B_2 PDB CREDO	0.680	0.097	0.533	0.007
Rv2380c.3	3	2bxp_P1Z_A_3001 PDB CREDO	0.587	0.195	0.533	0.007
Rv2380c.3	29	2uxo_TAC_B_1211 PDB CREDO	0.576	0.208	0.532	0.007
Rv2380c.3	5	4eyb_0WO_A_303 PDB CREDO	0.551	0.242	0.532	0.007
Rv2380c.3	11	3jw3_TOP_A_208 PDB CREDO	0.625	0.150	0.532	0.007
Rv2380c.3	38	3r9c_ECL_A_451 PDB CREDO	0.532	0.270	0.532	0.007
Rv2380c.3	11	1ere_EST_B_600 PDB CREDO	0.679	0.098	0.532	0.007
Rv2380c.3	38	1uay_ADN_A_1001 PDB CREDO	0.679	0.098	0.532	0.007
Rv2380c.3	29	3k2h_LYA_B_514 PDB CREDO	0.640	0.135	0.531	0.007
Rv2380c.3	5	2zi9_CL9_A_401 PDB CREDO	0.591	0.190	0.531	0.007
Rv2380c.3	5	2prg_BRL_A_1 PDB CREDO	0.549	0.246	0.530	0.007
Rv2380c.3	5	3kw2_ADN_A_300 PDB CREDO	0.612	0.165	0.530	0.007
Rv2380c.3	11	1ere_EST_E_600 PDB CREDO	0.676	0.100	0.530	0.007
Rv2380c.3	29	3g0e_B49_A_9000 PDB CREDO	0.573	0.213	0.529	0.007
Rv2380c.3	29	3ti1_B49_A_299 PDB CREDO	0.529	0.274	0.529	0.007
Rv2380c.7	1	3tbg_RTZ_B_1 PDB CREDO	0.529	0.274	0.529	0.007
Rv2380c.6	6	1t46_STI_A_3 PDB CREDO	0.602	0.177	0.529	0.007
Rv2380c.2	4	1opj_STI_A_3 PDB CREDO	0.669	0.107	0.529	0.007
Rv2380c.3	5	1zgy_BRL_A_503 PDB CREDO	0.566	0.222	0.529	0.007
Rv2380c.1	1	1sn5_T3_C_601 PDB CREDO	0.598	0.182	0.529	0.007
Rv2380c.3	29	3r9c_ECL_A_452 PDB CREDO	0.621	0.155	0.528	0.007
Rv2380c.3	29	1zgf_TRU_A_300 PDB CREDO	0.548	0.246	0.528	0.007
Rv2380c.3	11	1ere_EST_A_600 PDB CREDO	0.673	0.103	0.527	0.007
Rv2380c.6	6	2xkw_P1B_A_1478 PDB CREDO	0.554	0.238	0.527	0.007
Rv2380c.3	8	1cil_ETS_A_263 PDB CREDO	0.545	0.251	0.527	0.007
Rv2380c.2	4	2qxs_RAL_B_600 PDB CREDO	0.647	0.128	0.526	0.007
Rv2380c.3	5	2fum_MIX_D_3539 PDB CREDO	0.544	0.252	0.526	0.007
Rv2380c.3	5	2h79_T3_A_1 PDB CREDO	0.582	0.201	0.526	0.007
Rv2380c.3	5	1bsx_T3_A_1 PDB CREDO	0.601	0.177	0.526	0.007
Rv2380c.3	5	1bsx_T3_B_2 PDB CREDO	0.601	0.177	0.526	0.007
Rv2380c.1	1	3ti1_B49_A_299 PDB CREDO	0.547	0.249	0.526	0.007
Rv2380c.2	4	1opj_STI_B_4 PDB CREDO	0.664	0.111	0.525	0.007
Rv2380c.7	1	3miy_B49_B_2 PDB CREDO	0.550	0.243	0.525	0.007
Rv2380c.3	5	2h42_VIA_B_902 PDB CREDO	0.564	0.225	0.525	0.007
Rv2380c.3	11	2x1l_ADN_A_601 PDB CREDO	0.525	0.280	0.525	0.007
Rv2380c.3	3	2x7h_PFN_A_1372 PDB CREDO	0.578	0.206	0.525	0.007
Rv2380c.3	29	2xn7_T44_A_1355 PDB CREDO	0.568	0.219	0.525	0.007
Rv2380c.1	1	1m17_AQ4_A_999 PDB CREDO	0.569	0.218	0.525	0.007
Rv2380c.3	5	3gws_T3_X_500 PDB CREDO	0.600	0.179	0.525	0.007
Rv2380c.3	29	2xn6_T44_A_1370 PDB CREDO	0.567	0.220	0.524	0.008
Rv2380c.3	29	2pou_I7A_A_1000 PDB CREDO	0.544	0.252	0.524	0.008
Rv2380c.3	29	3f4x_KLT_A_300 PDB CREDO	0.544	0.252	0.524	0.008
Rv2380c.3	5	4eyb_0WO_B_301 PDB CREDO	0.583	0.200	0.524	0.008
Rv2380c.3	5	1cil_ETS_A_263 PDB CREDO	0.542	0.255	0.524	0.008
Rv2380c.2	4	2qxs_RAL_A_600 PDB CREDO	0.644	0.131	0.524	0.008
Rv2380c.3	11	1g50_EST_B_1600 PDB CREDO	0.668	0.107	0.523	0.008
Rv2380c.3	29	1fm6_BRL_D_503 PDB CREDO	0.630	0.145	0.523	0.008
Rv2380c.3	8	1d4f_ADN_C_603 PDB CREDO	0.541	0.256	0.523	0.008
Rv2380c.3	29	3g5d_1N1_B_1 PDB CREDO	0.523	0.284	0.523	0.008
Rv2380c.3	5	3qgz_ADN_A_127 PDB CREDO	0.581	0.202	0.522	0.008
Rv2380c.1	1	3jwq_VIA_B_901 PDB CREDO	0.631	0.144	0.522	0.008
Rv2380c.3	29	2a69_RPT_C_8001 PDB CREDO	0.563	0.226	0.522	0.008
Rv2380c.3	29	3aod_RFP_C_2002 PDB CREDO	0.584	0.198	0.522	0.008
Rv2380c.3	29	3g5d_1N1_A_1 PDB CREDO	0.522	0.285	0.522	0.008
Rv2380c.3	8	3nrr_D16_B_520 PDB CREDO	0.521	0.285	0.521	0.008
Rv2380c.2	4	1c6z_ROC_B_505 PDB CREDO	0.534	0.266	0.521	0.008
Rv2380c.7	1	3miy_B49_A_1 PDB CREDO	0.546	0.250	0.521	0.008
Rv2380c.3	29	3bl1_BL1_A_300 PDB CREDO	0.541	0.256	0.521	0.008
Rv2380c.3	5	1gs4_ZK5_A_1918 PDB CREDO	0.559	0.231	0.521	0.008
Rv2380c.1	1	3ads_IMN_B_3 PDB CREDO	0.614	0.162	0.521	0.008
Rv2380c.3	29	3sv6_SV6_A_1 PDB CREDO	0.520	0.287	0.520	0.008
Rv2380c.6	6	1xkk_FMM_A_91 PDB CREDO	0.561	0.229	0.520	0.008
Rv2380c.1	1	3qgz_ADN_A_127 PDB CREDO	0.605	0.172	0.520	0.008
Rv2380c.3	11	1uay_ADN_B_1002 PDB CREDO	0.647	0.127	0.520	0.008
Rv2380c.3	38	2eva_ADN_A_498 PDB CREDO	0.575	0.210	0.520	0.008
Rv2380c.1	1	1sn0_T44_C_601 PDB CREDO	0.669	0.107	0.519	0.008
Rv2380c.1	1	1jg3_ADN_B_550 PDB CREDO	0.540	0.259	0.519	0.008
Rv2380c.6	6	3prs_RIT_A_1001 PDB CREDO	0.532	0.270	0.519	0.008
Rv2380c.3	38	1sn0_T44_B_602 PDB CREDO	0.518	0.290	0.518	0.008
Rv2380c.3	11	1qku_EST_A_600 PDB CREDO	0.661	0.114	0.518	0.008
Rv2380c.3	29	3o1c_ADN_A_127 PDB CREDO	0.580	0.204	0.518	0.008
Rv2380c.3	29	3sv7_SV6_A_1 PDB CREDO	0.517	0.292	0.517	0.008
Rv2380c.3	5	3k54_1N1_A_1 PDB CREDO	0.576	0.209	0.517	0.008
Rv2380c.3	8	1a4l_DCF_A_353 PDB CREDO	0.555	0.237	0.517	0.008
Rv2380c.3	5	1fm6_BRL_X_504 PDB CREDO	0.611	0.166	0.517	0.008
Rv2380c.3	11	1qku_EST_C_600 PDB CREDO	0.660	0.115	0.517	0.008
Rv2380c.1	1	2uxp_CLM_B_1211 PDB CREDO	0.697	0.083	0.517	0.008
Rv2380c.3	29	3cs8_BRL_A_503 PDB CREDO	0.537	0.262	0.517	0.008
Rv2380c.3	29	3qlg_1N1_B_601 PDB CREDO	0.517	0.293	0.517	0.008
Rv2380c.3	29	4eb6_VLB_C_503 PDB CREDO	0.600	0.180	0.516	0.009
Rv2380c.3	5	3ua1_08Y_A_600 PDB CREDO	0.610	0.167	0.516	0.009
Rv2380c.1	1	3f4x_KLT_A_300 PDB CREDO	0.558	0.233	0.516	0.009
Rv2380c.3	29	2xrl_DXT_A_1211 PDB CREDO	0.633	0.142	0.516	0.009
Rv2380c.6	6	1uwj_BAX_A_1723 PDB CREDO	0.672	0.103	0.516	0.009
Rv2380c.3	5	2h42_VIA_A_901 PDB CREDO	0.534	0.267	0.515	0.009
Rv2380c.3	8	2x9g_LYA_C_1270 PDB CREDO	0.515	0.295	0.515	0.009
Rv2380c.3	34	3n0h_TOP_A_187 PDB CREDO	0.538	0.261	0.515	0.009
Rv2380c.1	1	1z9y_FUN_A_500 PDB CREDO	0.557	0.234	0.515	0.009
Rv2380c.3	38	3grv_ADN_A_300 PDB CREDO	0.628	0.148	0.515	0.009
Rv2380c.5	3	1pg2_ADN_A_552 PDB CREDO	0.567	0.221	0.515	0.009
Rv2380c.3	5	1kij_NOV_B_444 PDB CREDO	0.618	0.159	0.515	0.009
Rv2380c.3	11	1qku_EST_B_600 PDB CREDO	0.657	0.117	0.515	0.009
Rv2380c.3	5	3apw_DP0_A_190 PDB CREDO	0.570	0.217	0.515	0.009
Rv2380c.2	4	3k5v_STI_A_2 PDB CREDO	0.669	0.107	0.515	0.009
Rv2380c.3	34	2no6_ETV_B_302 PDB CREDO	0.537	0.262	0.514	0.009
Rv2380c.3	29	2bxg_IBP_B_2001 PDB CREDO	0.631	0.144	0.514	0.009
Rv2380c.3	5	3o1c_ADN_A_127 PDB CREDO	0.572	0.214	0.514	0.009
Rv2380c.3	34	2w4x_STZ_A_1591 PDB CREDO	0.537	0.263	0.514	0.009
Rv2380c.1	1	3k54_1N1_A_1 PDB CREDO	0.598	0.181	0.514	0.009
Rv2380c.3	5	2q1v_PDN_A_248 PDB CREDO	0.514	0.297	0.514	0.009
Rv2380c.3	5	2zbv_ADN_A_501 PDB CREDO	0.572	0.215	0.514	0.009
Rv2380c.3	5	3k2h_LYA_A_514 PDB CREDO	0.640	0.134	0.514	0.009
Rv2380c.3	11	1qhy_CLM_A_999 PDB CREDO	0.568	0.219	0.513	0.009
Rv2380c.3	5	1xzx_T3_X_500 PDB CREDO	0.606	0.172	0.513	0.009
Rv2380c.3	8	1a4l_DCF_C_1353 PDB CREDO	0.551	0.243	0.513	0.009
Rv2380c.3	8	1a4l_DCF_D_1853 PDB CREDO	0.551	0.243	0.513	0.009
Rv2380c.3	11	3ret_SAL_B_201 PDB CREDO	0.571	0.216	0.513	0.009
Rv2380c.2	4	3bjw_SVR_C_505 PDB CREDO	0.614	0.163	0.513	0.009
Rv2380c.3	8	1a4l_DCF_B_853 PDB CREDO	0.550	0.244	0.512	0.009
Rv2380c.1	1	2ito_IRE_A_2020 PDB CREDO	0.554	0.239	0.512	0.009
Rv2380c.3	11	3tmz_06X_A_504 PDB CREDO	0.567	0.221	0.512	0.009
Rv2380c.3	29	2prg_BRL_A_1 PDB CREDO	0.616	0.160	0.512	0.009
Rv2380c.1	1	2xkw_P1B_B_1475 PDB CREDO	0.618	0.158	0.512	0.009
Rv2380c.7	1	2vpp_GEO_A_1210 PDB CREDO	0.512	0.300	0.512	0.009
Rv2380c.3	11	3fl9_TOP_H_200 PDB CREDO	0.538	0.260	0.512	0.009
Rv2380c.3	38	1uay_ADN_B_1002 PDB CREDO	0.637	0.138	0.511	0.009
Rv2380c.3	29	3ln1_CEL_D_682 PDB CREDO	0.660	0.115	0.511	0.009
Rv2380c.3	8	2x9g_LYA_D_1270 PDB CREDO	0.511	0.301	0.511	0.009
Rv2380c.2	4	3bjw_SVR_G_506 PDB CREDO	0.595	0.184	0.511	0.009
Rv2380c.3	29	3znc_BZ1_A_500 PDB CREDO	0.531	0.271	0.511	0.009
Rv2380c.3	8	3kw2_ADN_A_300 PDB CREDO	0.590	0.191	0.511	0.009
Rv2380c.3	29	3g1u_ADN_B_438 PDB CREDO	0.531	0.271	0.511	0.009
Rv2380c.2	4	3kk6_CEL_A_701 PDB CREDO	0.564	0.224	0.510	0.009
Rv2380c.3	5	1p93_DEX_A_1999 PDB CREDO	0.528	0.275	0.510	0.009
Rv2380c.3	5	1p93_DEX_B_2999 PDB CREDO	0.528	0.275	0.510	0.009
Rv2380c.2	4	1uwj_BAX_B_1723 PDB CREDO	0.744	0.051	0.510	0.009
Rv2380c.1	1	3oht_1N1_B_1000 PDB CREDO	0.638	0.136	0.510	0.009
Rv2380c.1	1	2ceo_T44_B_1395 PDB CREDO	0.628	0.147	0.510	0.009
Rv2380c.1	1	2uxp_CLM_A_1211 PDB CREDO	0.687	0.091	0.510	0.009
Rv2380c.3	29	3qlg_1N1_A_601 PDB CREDO	0.510	0.303	0.510	0.009
Rv2380c.3	29	3k54_1N1_A_1 PDB CREDO	0.571	0.216	0.510	0.009
Rv2380c.3	34	1wu8_ADN_A_500 PDB CREDO	0.532	0.270	0.510	0.009
Rv2380c.2	4	1ya4_CTX_A_1 PDB CREDO	0.522	0.284	0.510	0.009
Rv2380c.3	11	3hm1_J3Z_A_2 PDB CREDO	0.650	0.124	0.510	0.009
Rv2380c.3	5	1qkn_RAL_A_600 PDB CREDO	0.583	0.200	0.509	0.009
Rv2380c.3	6	1d4f_ADN_B_602 PDB CREDO	0.548	0.247	0.509	0.009
Rv2380c.3	5	1a27_EST_A_350 PDB CREDO	0.634	0.140	0.509	0.010
Rv2380c.3	11	2w9s_TOP_A_1160 PDB CREDO	0.509	0.305	0.509	0.010
Rv2380c.3	29	1m17_AQ4_A_999 PDB CREDO	0.573	0.213	0.508	0.010
Rv2380c.1	1	1mx1_THA_A_1 PDB CREDO	0.574	0.211	0.508	0.010
Rv2380c.3	5	2gqg_1N1_B_502 PDB CREDO	0.563	0.227	0.508	0.010
Rv2380c.1	1	3oct_1N1_A_663 PDB CREDO	0.659	0.116	0.508	0.010
Rv2380c.3	8	4eb6_VLB_C_503 PDB CREDO	0.545	0.250	0.508	0.010
Rv2380c.2	4	3oez_STI_A_601 PDB CREDO	0.698	0.082	0.508	0.010
Rv2380c.1	1	2ceo_T44_A_1395 PDB CREDO	0.625	0.150	0.507	0.010
Rv2380c.3	5	3uvv_T3_A_501 PDB CREDO	0.600	0.180	0.507	0.010
Rv2380c.5	3	3ilt_TRU_E_800 PDB CREDO	0.507	0.307	0.507	0.010
Rv2380c.3	5	1a28_STR_A_1 PDB CREDO	0.525	0.280	0.507	0.010
Rv2380c.3	34	3g0e_B49_A_9000 PDB CREDO	0.574	0.211	0.507	0.010
Rv2380c.2	4	1iep_STI_B_202 PDB CREDO	0.697	0.083	0.507	0.010
Rv2380c.1	1	1ict_T44_C_128 PDB CREDO	0.549	0.245	0.507	0.010
Rv2380c.3	5	3aod_RFP_C_2002 PDB CREDO	0.564	0.225	0.506	0.010
Rv2380c.2	4	2hyy_STI_C_600 PDB CREDO	0.696	0.084	0.506	0.010
Rv2380c.1	1	3jwq_VIA_D_901 PDB CREDO	0.679	0.098	0.506	0.010
Rv2380c.5	3	2y7j_B49_C_1294 PDB CREDO	0.506	0.309	0.506	0.010
Rv2380c.3	5	1lhv_NOG_A_301 PDB CREDO	0.598	0.182	0.506	0.010
Rv2380c.1	1	2bxc_P1Z_A_2001 PDB CREDO	0.548	0.246	0.506	0.010
Rv2380c.1	1	2itz_IRE_A_2021 PDB CREDO	0.527	0.278	0.506	0.010
Rv2380c.2	4	1iep_STI_A_201 PDB CREDO	0.696	0.084	0.506	0.010
Rv2380c.1	1	3erd_DES_A_600 PDB CREDO	0.611	0.166	0.506	0.010
Rv2380c.1	1	1kij_NOV_B_444 PDB CREDO	0.547	0.249	0.506	0.010
Rv2380c.3	5	1ya3_STR_B_2001 PDB CREDO	0.506	0.309	0.506	0.010
Rv2380c.2	4	3pyy_STI_B_4 PDB CREDO	0.695	0.084	0.506	0.010
Rv2380c.6	6	1c6z_ROC_B_505 PDB CREDO	0.506	0.310	0.506	0.010
Rv2380c.3	29	1ie4_T44_B_328 PDB CREDO	0.505	0.310	0.505	0.010
Rv2380c.3	29	3g1u_ADN_A_438 PDB CREDO	0.525	0.279	0.505	0.010
Rv2380c.3	34	3hp1_LLT_A_401 PDB CREDO	0.552	0.242	0.505	0.010
Rv2380c.3	11	2w9s_TOP_C_1160 PDB CREDO	0.505	0.311	0.505	0.010
Rv2380c.2	4	3mss_STI_C_1 PDB CREDO	0.694	0.085	0.505	0.010
Rv2380c.3	29	3oct_1N1_A_663 PDB CREDO	0.629	0.146	0.505	0.010
Rv2380c.1	1	3fuu_ADN_A_0 PDB CREDO	0.525	0.281	0.505	0.010
Rv2380c.3	29	3adx_IMN_B_3 PDB CREDO	0.546	0.249	0.505	0.010
Rv2380c.2	4	3mss_STI_A_1 PDB CREDO	0.694	0.086	0.504	0.010
Rv2380c.1	1	1mrl_DOL_A_300 PDB CREDO	0.570	0.217	0.504	0.010
Rv2380c.1	1	2riw_T44_A_1395 PDB CREDO	0.570	0.217	0.504	0.010
Rv2380c.3	5	2zia_CL9_A_401 PDB CREDO	0.628	0.147	0.504	0.010
Rv2380c.3	11	3grv_ADN_A_300 PDB CREDO	0.614	0.163	0.504	0.010
Rv2380c.3	29	3jwq_VIA_D_901 PDB CREDO	0.650	0.124	0.504	0.010
Rv2380c.2	4	2hyy_STI_D_600 PDB CREDO	0.693	0.086	0.504	0.010
Rv2380c.1	1	1ki3_PE2_A_1 PDB CREDO	0.504	0.313	0.504	0.010
Rv2380c.2	4	2hyy_STI_A_600 PDB CREDO	0.692	0.087	0.503	0.010
Rv2380c.2	4	3nxu_RIT_A_600 PDB CREDO	0.619	0.157	0.503	0.010
Rv2380c.3	11	3fl9_TOP_B_200 PDB CREDO	0.503	0.313	0.503	0.010
Rv2380c.3	11	3fl9_TOP_G_200 PDB CREDO	0.503	0.313	0.503	0.010
Rv2380c.3	5	2kce_D16_A_566 PDB CREDO	0.604	0.174	0.503	0.010
Rv2380c.3	6	1d4f_ADN_D_604 PDB CREDO	0.542	0.256	0.503	0.010
Rv2380c.2	4	3k5v_STI_B_2 PDB CREDO	0.692	0.087	0.503	0.010
Rv2380c.2	4	3ms9_STI_A_1 PDB CREDO	0.692	0.087	0.503	0.010
Rv2380c.3	29	1i2w_CFX_A_1300 PDB CREDO	0.544	0.252	0.503	0.010
Rv2380c.3	29	2ayl_FLP_A_1701 PDB CREDO	0.503	0.314	0.503	0.010
Rv2380c.2	4	3nxu_RIT_B_600 PDB CREDO	0.618	0.158	0.503	0.010
Rv2380c.3	38	3uq6_ADN_B_401 PDB CREDO	0.613	0.164	0.503	0.010
Rv2380c.3	8	1oq5_CEL_A_701 PDB CREDO	0.540	0.259	0.503	0.010
Rv2380c.2	4	3pyy_STI_A_3 PDB CREDO	0.691	0.088	0.503	0.010
Rv2380c.3	8	3tne_RIT_B_401 PDB CREDO	0.613	0.164	0.502	0.011
Rv2380c.5	3	1m2w_MTL_B_6600 PDB CREDO	0.502	0.315	0.502	0.011
Rv2380c.3	5	1nhz_486_A_800 PDB CREDO	0.538	0.261	0.502	0.011
Rv2380c.2	4	1skx_RFP_A_1 PDB CREDO	0.618	0.159	0.502	0.011
Rv2380c.2	4	3gvu_STI_A_1001 PDB CREDO	0.691	0.088	0.502	0.011
Rv2380c.3	5	1s9p_DES_D_600 PDB CREDO	0.520	0.288	0.502	0.011
Rv2380c.3	5	3h52_486_C_4 PDB CREDO	0.539	0.260	0.502	0.011
Rv2380c.3	11	3fl9_TOP_E_200 PDB CREDO	0.590	0.191	0.502	0.011
Rv2380c.3	38	2w9s_TOP_C_1160 PDB CREDO	0.502	0.315	0.502	0.011
Rv2380c.1	1	1xp0_VDN_A_201 PDB CREDO	0.592	0.189	0.502	0.011
Rv2380c.3	29	2xkw_P1B_B_1475 PDB CREDO	0.583	0.200	0.502	0.011
Rv2380c.3	29	3qgz_ADN_A_127 PDB CREDO	0.562	0.228	0.502	0.011
Rv2380c.2	4	3ms9_STI_B_1 PDB CREDO	0.690	0.089	0.502	0.011
Rv2380c.2	4	3mss_STI_B_1 PDB CREDO	0.690	0.089	0.502	0.011
Rv2380c.2	4	3mss_STI_D_1 PDB CREDO	0.690	0.089	0.502	0.011
Rv2380c.3	29	2bxc_P1Z_A_2001 PDB CREDO	0.565	0.223	0.502	0.011
Rv2380c.2	4	3bjw_SVR_F_509 PDB CREDO	0.514	0.297	0.501	0.011
Rv2380c.2	4	3bjw_SVR_H_511 PDB CREDO	0.514	0.297	0.501	0.011
Rv2380c.3	38	3s20_CER_A_1 PDB CREDO	0.528	0.276	0.501	0.011
Rv2380c.1	1	3lfa_1N1_A_361 PDB CREDO	0.566	0.221	0.501	0.011
Rv2380c.3	29	3g1u_ADN_C_438 PDB CREDO	0.541	0.257	0.501	0.011
Rv2380c.3	29	1ki3_PE2_A_1 PDB CREDO	0.521	0.286	0.501	0.011
Rv2380c.3	11	3fl9_TOP_D_200 PDB CREDO	0.589	0.193	0.501	0.011
Rv2380c.3	11	3ret_SAL_A_201 PDB CREDO	0.557	0.234	0.501	0.011
Rv2380c.1	1	2h77_T3_A_1 PDB CREDO	0.695	0.085	0.501	0.011
Rv2380c.1	1	1uof_PNN_A_1312 PDB CREDO	0.521	0.286	0.500	0.011
Rv2380c.3	34	2x0y_X0T_B_1625 PDB CREDO	0.590	0.191	0.500	0.011
Rv2380c.1	1	3ln1_CEL_D_682 PDB CREDO	0.671	0.104	0.500	0.011
Rv2380c.2	4	1y0x_T44_X_500 PDB CREDO	0.774	0.035	0.500	0.011

Similarity to known drug target from sensitive sequence analysis

No drug targets

List of small molecules tested from TIBLE

Data not available

Off-target activity - ligand based from TIBLE

Data not available

Small molecules involved in protein-protein complex from TIMBAL .Proteins similar to Mtb based on sequence analysis.

Data not available

STITCH interactions

No high confidence interactions