SInCRe - Rv2379c

Tuberculist information

Gene name	mbtF
Protein function	Peptide synthetase MbtF (peptide synthase)
Functional category(tuberculist)	lipid metabolism
Gene location(kb)	2657.7
Molecular mass(da)	156748
External sites	TB Database TubercuList WebTB

Protein sequence

Number of amino acids : 1461

	  		  	1    MGPVAVTRADARGAIDDVMALSPLQQGLFSRATLVAAESGSEAAEADPYVIAMAADAAGP   60
			  	61   LDIALLRDCAAAMLTRHPNLRASFLHGNLSRPVQVIPSSAEVLWRHVRAHPSEVGALAAE  120
			  	121  ERRRRFDVGRGPLIRFLLIELPDECWHLVIVAHHIVIDGWSLPLFVSELLALYRAGGHVA  180
			  	181  ALPAAPRPYRDYIGWLAGRDQTASRAMWADHLNGLDGPTLLSPALADTPVQPGIPGRTEV  240
			  	241  RLDREATAELADAARTRGVTISTLVQMAWATTLSAFTGRGDVTFGVTVSGRPSELSGVET  300
			  	301  MIGLFINTVPLRVRLDARATVGGQCAVLQRQFAMLRDHSYLGFNEFRAIAGIGEMFDTLL  360
			  	361  VYENFPPGEVVGTAEFVANGVTFRPVALESLSHFPVTVAAHRSTGELTLLVEVLDGALGT  420
			  	421  MAPESLGRRVLAVLQRLVSRWDRPLRDVDILLDGEHDPTAPGLPDVTTSAPAVHTRFAEI  480
			  	481  AAAQPDSVAVSWADGQLTYRELDALADRLATGLRRADVSRETPVAVALSRGPRYVAAMLA  540
			  	541  VLKAGGMIVPLDPAMPGERVAEILRQTSAPVVIDEGVFAASVGADILEEDRAITVPVDQA  600
			  	601  AYVIFTSGTTGTPKGVIGTHRALSAYADDHIERVLRPAAQRLGRPLRIAHAWSFTFDAAW  660
			  	661  QPLVALLDGHAVHIVDDHRQRDAGALVEAIDRFGLDMIDTTPSMFAQLHNAGLLDRAPLA  720
			  	721  VLALGGEALGAATWRMIQQNCARTAMTAFNCYGPTETTVEAVVAAVAEHARPVIGRPTCT  780
			  	781  TRAYVMDSWLRPVPDGVAGELYLAGAQLTRGYLGRPAETAARFVAEPNGRGSRMYRTGDV  840
			  	841  VRRLPDGGLEFLGRSDDQVKIRGFRVEPGEIAAVLNGHHAVHGCHVTARGHASGPRLTAY  900
			  	901  VAGGPQPPPVAELRAMLLERLPRYLVPHHIVVLDELPLTPHGKIDENALAAINVTEGPAT  960
			  	961  PPQTPTELVLAEAFADVMETSNVDVTAGFLQMGLDSIVALSVVQAARRRGIALRARLMVE 1020
			  	1021 CDTIRELAAAIDSDAAWQAPANDAGEPIPVLPNTHWLYEYGDPRRLAQTEVIRLPDRITR 1080
			  	1081 ERLDAVLAAVVDGHEVLRCRFDRDAMALVAQPKTDILSEVWVSGELVTAVAEQTLGALAS 1140
			  	1141 LDPQAGRLLSAVWLREPDGPGVLVLTAHVLAMDPASWRIVLGELDAGLHALAAGRAPSPA 1200
			  	1201 RENTSYRQWSRLLAQRAKALDSVDFWVAELEGADPPLGARRVAPQTDRVGELAITMSISD 1260
			  	1261 ADLTARLLSTGRSMTDLLATAAARMVTAWRRQRGQQTPAPLLALETHGRADVHVDKTADT 1320
			  	1321 SDTVGLLSAIYPLRIHCDGATDFARIPGSGIDYGLLRYLRADTAERLRAHREPQLLLNYL 1380
			  	1381 GSLHVGVGDLAVDRALLADVGQLPEPEQPVRHELTVLAALLGPADAPVLATRWRTLPDIL 1440
			  	1441 SADDVATLQSLWQGALAEITA

Known structures in the PDB

No Known structures

Number of amino acids : 1461

Domains assigned based on sequence.

Mtb Structural proteome models

CHOPIN models

Profile-based domain assignment

Structural/Functional domain family	Pfam acc.no./SCOP ID	Domain Region
Condensation	PF00668	15-316
AMP-binding	PF00501	477-862
AMP-binding_C	PF13193	870-943
PP-binding	PF00550	968-1031
Condensation	PF00668	1060-1338

Mtb Structural Proteome models

Model Number	1
Model name	Rv2379c.4
Template	1DNY APDB CREDO
Template coverage	8_83
Template Identity(%)	25.3
Model coverage(%)	5.1
Normalized DOPE score	-0.782

Model Number	2
Model name	Rv2379c
Template	1AMU APDB CREDO
Template coverage	35_524
Template Identity(%)	30.0
Model coverage(%)	33.1
Normalized DOPE score	-0.183

Model Number	3
Model name	Rv2379c.2
Template	1PG4 APDB CREDO
Template coverage	7_646
Template Identity(%)	19.6
Model coverage(%)	39.8
Normalized DOPE score	0.018

Model Number	4
Model name	Rv2379c.1
Template	1L5A APDB CREDO
Template coverage	1_418
Template Identity(%)	16.3
Model coverage(%)	29.4
Normalized DOPE score	0.118

Structure Models from Chopin

Model Number	1
Profile	e.23.1.1 Click for model details
zscore	40.04
Residue begin	498
Residue end	886

Model Number	2
Profile	2.30.38.10 Click for model details
zscore	15.75
Residue begin	774
Residue end	853

Model Number	3
Profile	a.28.1.2 - 1.10.1200.10 Click for model details
zscore	11.82
Residue begin	968
Residue end	1031

Model Number	4
Profile	c.43.1.2 Click for model details
zscore	10.12
Residue begin	8
Residue end	188

Model Number	5
Profile	c.43.1.2 Click for model details
zscore	10.12
Residue begin	1067
Residue end	1247

Binding pockets

STRING

Cytoscape Web will replace the contents of this div with protein-protein interaction network.

Protein interacting with Rv2379c	Gene name	Confidence Score
Rv2377c	mbtH	0.996
Rv2380c	mbtE	0.97
Rv2380c	mbtE	0.97
Rv2380c	mbtE	0.97
Rv2380c	mbtE	0.97
Rv2380c	mbtE	0.97
Rv2378c	mbtG	0.955
Rv2382c	mbtC	0.932
Rv2382c	mbtC	0.932

Potential ligand/drug binding sites

Protein Model	Pocket Number	Drug Binding Site	PMIN Score	Pvalue PMIN	PMAX Score	Pvalue PMAX
Rv2379c.1	2	3el4_ROC_A_100 PDB CREDO	0.705	0.077	0.689	0.000
Rv2379c.1	2	2q64_1UN_B_1001 PDB CREDO	0.713	0.071	0.662	0.001
Rv2379c.1	2	2qak_1UN_A_1001 PDB CREDO	0.712	0.072	0.662	0.001
Rv2379c.1	2	2pym_1UN_A_1001 PDB CREDO	0.710	0.073	0.660	0.001
Rv2379c.1	2	2nnk_ROC_A_401 PDB CREDO	0.660	0.115	0.660	0.001
Rv2379c.1	2	2pyn_1UN_A_1001 PDB CREDO	0.710	0.073	0.660	0.001
Rv2379c.1	2	2q63_1UN_A_1001 PDB CREDO	0.707	0.076	0.657	0.001
Rv2379c.1	2	3ndt_ROC_D_100 PDB CREDO	0.656	0.118	0.656	0.001
Rv2379c.1	2	3ufn_ROC_A_401 PDB CREDO	0.780	0.033	0.655	0.001
Rv2379c.1	2	1t7i_017_A_200 PDB CREDO	0.666	0.110	0.650	0.001
Rv2379c.1	2	2f80_017_B_301 PDB CREDO	0.693	0.086	0.644	0.001
Rv2379c.1	2	3k4v_ROC_D_201 PDB CREDO	0.674	0.102	0.643	0.001
Rv2379c.1	2	1c6z_ROC_B_505 PDB CREDO	0.688	0.090	0.639	0.001
Rv2379c.1	2	2nnp_ROC_A_401 PDB CREDO	0.650	0.125	0.634	0.001
Rv2379c.1	2	3bvb_017_B_401 PDB CREDO	0.644	0.130	0.629	0.001
Rv2379c.1	2	1k6c_MK1_B_902 PDB CREDO	0.644	0.131	0.629	0.001
Rv2379c.1	2	3sm2_478_A_126 PDB CREDO	0.690	0.088	0.626	0.001
Rv2379c.1	2	3ndu_ROC_D_100 PDB CREDO	0.682	0.095	0.621	0.001
Rv2379c.1	2	3d1y_ROC_A_201 PDB CREDO	0.650	0.124	0.619	0.001
Rv2379c.1	2	2qxs_RAL_B_600 PDB CREDO	0.799	0.025	0.619	0.001
Rv2379c.1	2	3ogq_AB1_A_200 PDB CREDO	0.700	0.081	0.618	0.001
Rv2379c.1	2	1ya4_CTX_A_1 PDB CREDO	0.632	0.142	0.617	0.002
Rv2379c.1	2	2qxs_RAL_A_600 PDB CREDO	0.796	0.026	0.616	0.002
Rv2379c.1	2	1rl8_RIT_A_9001 PDB CREDO	0.645	0.129	0.614	0.002
Rv2379c.1	2	3pwr_ROC_A_401 PDB CREDO	0.629	0.146	0.614	0.002
Rv2379c.1	2	3el5_1UN_B_201 PDB CREDO	0.677	0.099	0.614	0.002
Rv2379c.1	2	1hxb_ROC_A_100 PDB CREDO	0.660	0.115	0.613	0.002
Rv2379c.1	2	3ucb_017_A_201 PDB CREDO	0.613	0.164	0.613	0.002
Rv2379c.1	2	1n49_RIT_B_301 PDB CREDO	0.806	0.022	0.608	0.002
Rv2379c.1	2	3gp0_NIL_A_1 PDB CREDO	0.722	0.065	0.606	0.002
Rv2379c.1	7	1uwj_BAX_A_1723 PDB CREDO	0.618	0.158	0.601	0.002
Rv2379c.1	2	2nmy_ROC_A_401 PDB CREDO	0.674	0.102	0.600	0.002
Rv2379c.1	2	1c6y_MK1_B_524 PDB CREDO	0.748	0.049	0.596	0.002
Rv2379c.1	2	3tkg_ROC_C_901 PDB CREDO	0.635	0.140	0.592	0.002
Rv2379c.1	2	3prs_RIT_A_1001 PDB CREDO	0.621	0.155	0.592	0.002
Rv2379c.1	2	3el0_1UN_A_201 PDB CREDO	0.801	0.024	0.587	0.003
Rv2379c.1	2	3s56_ROC_A_201 PDB CREDO	0.737	0.055	0.587	0.003
Rv2379c.1	2	3cyx_ROC_A_201 PDB CREDO	0.642	0.132	0.585	0.003
Rv2379c.1	2	1n49_RIT_D_401 PDB CREDO	0.839	0.013	0.581	0.003
Rv2379c.1	2	3ekq_ROC_A_100 PDB CREDO	0.749	0.048	0.581	0.003
Rv2379c.1	2	3oxc_ROC_A_401 PDB CREDO	0.711	0.072	0.580	0.003
Rv2379c.1	2	3ggu_017_B_201 PDB CREDO	0.671	0.105	0.578	0.003
Rv2379c.1	2	2avv_MK1_A_901 PDB CREDO	0.592	0.189	0.578	0.003
Rv2379c.1	2	1xkk_FMM_A_91 PDB CREDO	0.670	0.106	0.577	0.003
Rv2379c.1	2	2avv_MK1_E_902 PDB CREDO	0.589	0.192	0.575	0.003
Rv2379c.1	2	3lzv_017_A_200 PDB CREDO	0.782	0.032	0.573	0.003
Rv2379c.1	2	3ekx_1UN_B_201 PDB CREDO	0.648	0.126	0.573	0.003
Rv2379c.2	11	3v5w_8PR_A_701 PDB CREDO	0.572	0.215	0.572	0.003
Rv2379c.1	2	1hxw_RIT_B_301 PDB CREDO	0.661	0.114	0.569	0.004
Rv2379c.1	2	1t46_STI_A_3 PDB CREDO	0.691	0.088	0.565	0.004
Rv2379c.1	2	1sdt_MK1_B_902 PDB CREDO	0.576	0.209	0.562	0.004
Rv2379c.1	2	3cs9_NIL_C_600 PDB CREDO	0.687	0.091	0.562	0.004
Rv2379c.1	2	3el9_DR7_A_100 PDB CREDO	0.706	0.076	0.562	0.004
Rv2379c.1	2	3oxx_DR7_C_100 PDB CREDO	0.590	0.192	0.562	0.004
Rv2379c.1	7	1hwk_117_B_1 PDB CREDO	0.594	0.186	0.561	0.004
Rv2379c.1	2	3cs9_NIL_D_600 PDB CREDO	0.686	0.092	0.561	0.004
Rv2379c.2	8	1a4l_DCF_A_353 PDB CREDO	0.560	0.230	0.560	0.004
Rv2379c.1	7	3d91_REM_A_350 PDB CREDO	0.627	0.148	0.559	0.004
Rv2379c.1	7	3d91_REM_B_350 PDB CREDO	0.626	0.149	0.558	0.004
Rv2379c.1	2	1hsh_MK1_A_401 PDB CREDO	0.699	0.081	0.557	0.004
Rv2379c.1	2	2aof_FRD_C_305 PDB CREDO	0.583	0.200	0.556	0.005
Rv2379c.1	2	3oxx_DR7_A_100 PDB CREDO	0.612	0.165	0.555	0.005
Rv2379c.2	8	1a4l_DCF_D_1853 PDB CREDO	0.555	0.238	0.555	0.005
Rv2379c.1	2	2aqu_DR7_B_300 PDB CREDO	0.611	0.166	0.554	0.005
Rv2379c.1	2	1ohr_1UN_A_201 PDB CREDO	0.696	0.084	0.554	0.005
Rv2379c.2	8	1a4l_DCF_C_1353 PDB CREDO	0.553	0.240	0.553	0.005
Rv2379c.1	7	3bjw_SVR_E_503 PDB CREDO	0.599	0.180	0.552	0.005
Rv2379c.2	8	1a4l_DCF_B_853 PDB CREDO	0.552	0.241	0.552	0.005
Rv2379c.1	2	2r5p_MK1_D_902 PDB CREDO	0.640	0.134	0.551	0.005
Rv2379c.1	2	3tkg_ROC_B_801 PDB CREDO	0.705	0.077	0.551	0.005
Rv2379c.1	2	2r5p_MK1_B_902 PDB CREDO	0.639	0.136	0.550	0.005
Rv2379c.1	7	1z2b_VLB_C_800 PDB CREDO	0.636	0.139	0.550	0.005
Rv2379c.1	2	3k4v_ROC_B_201 PDB CREDO	0.719	0.067	0.550	0.005
Rv2379c.1	2	3jw2_017_A_401 PDB CREDO	0.550	0.244	0.550	0.005
Rv2379c.1	2	3ogp_017_B_200 PDB CREDO	0.793	0.027	0.549	0.005
Rv2379c.2	11	2fum_MIX_D_3539 PDB CREDO	0.606	0.172	0.548	0.005
Rv2379c.1	2	3pww_ROC_A_1001 PDB CREDO	0.671	0.105	0.548	0.005
Rv2379c.1	2	2o4k_DR7_A_301 PDB CREDO	0.588	0.194	0.548	0.005
Rv2379c.1	2	2hs2_017_A_201 PDB CREDO	0.547	0.248	0.547	0.005
Rv2379c.2	11	2y6o_1N1_A_1892 PDB CREDO	0.565	0.224	0.547	0.005
Rv2379c.1	2	2fxe_DR7_A_102 PDB CREDO	0.634	0.140	0.546	0.005
Rv2379c.1	2	2fxd_DR7_A_102 PDB CREDO	0.686	0.092	0.546	0.005
Rv2379c.1	2	3d1z_017_B_201 PDB CREDO	0.546	0.250	0.546	0.005
Rv2379c.1	7	2v0z_C41_O_1327 PDB CREDO	0.625	0.151	0.546	0.005
Rv2379c.1	7	1uwj_BAX_B_1723 PDB CREDO	0.612	0.164	0.546	0.005
Rv2379c.2	11	1kij_NOV_A_400 PDB CREDO	0.603	0.175	0.546	0.005
Rv2379c.1	2	3em4_DR7_V_100 PDB CREDO	0.633	0.141	0.546	0.005
Rv2379c.1	2	3tl9_ROC_A_401 PDB CREDO	0.641	0.134	0.546	0.005
Rv2379c.1	2	3eky_DR7_A_100 PDB CREDO	0.631	0.144	0.543	0.006
Rv2379c.1	2	3ndt_ROC_A_101 PDB CREDO	0.725	0.063	0.543	0.006
Rv2379c.1	2	2aoi_FRD_C_305 PDB CREDO	0.581	0.202	0.540	0.006
Rv2379c.1	2	1sh9_RIT_B_301 PDB CREDO	0.678	0.099	0.540	0.006
Rv2379c.1	2	1t3r_017_A_1200 PDB CREDO	0.553	0.240	0.540	0.006
Rv2379c.1	2	3s43_478_A_401 PDB CREDO	0.567	0.221	0.540	0.006
Rv2379c.1	7	3frq_ERY_A_195 PDB CREDO	0.587	0.194	0.539	0.006
Rv2379c.1	2	1hsh_MK1_C_402 PDB CREDO	0.677	0.099	0.539	0.006
Rv2379c.2	10	1hk2_T44_A_3003 PDB CREDO	0.559	0.231	0.537	0.006
Rv2379c.1	7	1hwk_117_C_4 PDB CREDO	0.601	0.177	0.536	0.006
Rv2379c.1	2	3nuj_478_B_401 PDB CREDO	0.576	0.209	0.536	0.006
Rv2379c.2	15	3s20_CER_A_1 PDB CREDO	0.563	0.226	0.535	0.006
Rv2379c.1	7	1hwk_117_A_2 PDB CREDO	0.600	0.179	0.534	0.006
Rv2379c.1	2	3em3_478_B_200 PDB CREDO	0.605	0.173	0.534	0.006
Rv2379c.1	2	3ekv_478_A_200 PDB CREDO	0.604	0.174	0.534	0.006
Rv2379c.2	10	1wu8_ADN_B_501 PDB CREDO	0.556	0.236	0.533	0.007
Rv2379c.1	2	1sdv_MK1_B_902 PDB CREDO	0.652	0.123	0.533	0.007
Rv2379c.1	2	2avo_MK1_B_902 PDB CREDO	0.573	0.213	0.532	0.007
Rv2379c.1	2	4dqf_017_B_101 PDB CREDO	0.602	0.176	0.532	0.007
Rv2379c.1	7	1hwl_FBI_B_1 PDB CREDO	0.615	0.161	0.532	0.007
Rv2379c.1	2	3cyw_017_A_201 PDB CREDO	0.544	0.252	0.531	0.007
Rv2379c.1	7	1hwl_FBI_D_3 PDB CREDO	0.614	0.162	0.531	0.007
Rv2379c.1	2	2avs_MK1_B_902 PDB CREDO	0.572	0.215	0.531	0.007
Rv2379c.1	2	3nuo_478_B_478 PDB CREDO	0.633	0.142	0.531	0.007
Rv2379c.2	10	1wu8_ADN_A_500 PDB CREDO	0.552	0.241	0.530	0.007
Rv2379c.1	2	3nu4_478_B_401 PDB CREDO	0.648	0.127	0.530	0.007
Rv2379c.1	7	1uob_PNN_A_1311 PDB CREDO	0.612	0.165	0.529	0.007
Rv2379c.1	2	3cs9_NIL_A_600 PDB CREDO	0.702	0.079	0.529	0.007
Rv2379c.1	2	3ndw_RIT_A_100 PDB CREDO	0.556	0.236	0.529	0.007
Rv2379c.1	2	3ogp_017_A_200 PDB CREDO	0.834	0.014	0.529	0.007
Rv2379c.1	2	3so9_017_A_100 PDB CREDO	0.860	0.008	0.529	0.007
Rv2379c.1	2	2ieo_017_A_402 PDB CREDO	0.555	0.238	0.529	0.007
Rv2379c.2	8	2ya7_ZMR_D_1776 PDB CREDO	0.529	0.275	0.529	0.007
Rv2379c.1	2	2r5q_1UN_B_900 PDB CREDO	0.784	0.031	0.528	0.007
Rv2379c.1	2	3spk_TPV_B_100 PDB CREDO	0.784	0.031	0.528	0.007
Rv2379c.1	2	3d1x_ROC_A_201 PDB CREDO	0.648	0.127	0.528	0.007
Rv2379c.2	11	3tne_RIT_B_401 PDB CREDO	0.563	0.227	0.528	0.007
Rv2379c.2	11	3hec_STI_A_1 PDB CREDO	0.562	0.228	0.527	0.007
Rv2379c.1	2	3ekw_DR7_B_100 PDB CREDO	0.596	0.184	0.527	0.007
Rv2379c.1	2	3oxv_478_C_200 PDB CREDO	0.644	0.130	0.527	0.007
Rv2379c.2	8	3san_ZMR_A_901 PDB CREDO	0.545	0.250	0.526	0.007
Rv2379c.1	7	2nni_MTK_A_501 PDB CREDO	0.573	0.213	0.526	0.007
Rv2379c.2	11	3tne_RIT_A_401 PDB CREDO	0.561	0.229	0.526	0.007
Rv2379c.1	7	3tne_RIT_A_401 PDB CREDO	0.666	0.109	0.525	0.007
Rv2379c.1	2	2r5q_1UN_D_900 PDB CREDO	0.780	0.033	0.525	0.007
Rv2379c.2	11	3oez_STI_B_601 PDB CREDO	0.559	0.231	0.525	0.007
Rv2379c.4	6	1lin_TFP_A_153 PDB CREDO	0.561	0.229	0.525	0.007
Rv2379c.1	7	3bjw_SVR_H_504 PDB CREDO	0.616	0.160	0.524	0.008
Rv2379c.1	2	3cs9_NIL_B_600 PDB CREDO	0.677	0.100	0.524	0.008
Rv2379c.1	7	1hwl_FBI_A_2 PDB CREDO	0.606	0.172	0.524	0.008
Rv2379c.1	7	1hwl_FBI_C_4 PDB CREDO	0.606	0.172	0.524	0.008
Rv2379c.2	15	2oa1_ADN_B_2005 PDB CREDO	0.552	0.241	0.524	0.008
Rv2379c.2	8	3san_ZMR_B_901 PDB CREDO	0.543	0.254	0.523	0.008
Rv2379c.1	2	3el1_DR7_A_100 PDB CREDO	0.592	0.189	0.523	0.008
Rv2379c.1	7	3tne_RIT_B_401 PDB CREDO	0.663	0.112	0.523	0.008
Rv2379c.1	2	3nu6_478_B_401 PDB CREDO	0.674	0.102	0.522	0.008
Rv2379c.1	2	3em4_DR7_A_100 PDB CREDO	0.656	0.119	0.522	0.008
Rv2379c.1	2	4dqb_017_B_101 PDB CREDO	0.639	0.136	0.522	0.008
Rv2379c.2	15	2eva_ADN_A_498 PDB CREDO	0.578	0.207	0.522	0.008
Rv2379c.4	6	1lin_TFP_A_156 PDB CREDO	0.559	0.231	0.522	0.008
Rv2379c.1	7	3bjw_SVR_B_501 PDB CREDO	0.613	0.164	0.522	0.008
Rv2379c.1	2	1sdu_MK1_B_902 PDB CREDO	0.589	0.192	0.521	0.008
Rv2379c.1	7	1t46_STI_A_3 PDB CREDO	0.580	0.203	0.520	0.008
Rv2379c.1	7	1lhv_NOG_A_301 PDB CREDO	0.680	0.097	0.520	0.008
Rv2379c.1	7	3bjw_SVR_F_502 PDB CREDO	0.611	0.166	0.520	0.008
Rv2379c.1	2	3rgf_BAX_A_465 PDB CREDO	0.728	0.061	0.519	0.008
Rv2379c.2	10	1ki3_PE2_A_1 PDB CREDO	0.563	0.226	0.519	0.008
Rv2379c.1	2	3pwm_017_B_402 PDB CREDO	0.531	0.271	0.519	0.008
Rv2379c.1	2	4dqc_017_A_101 PDB CREDO	0.669	0.107	0.518	0.008
Rv2379c.1	7	1uwh_BAX_B_1723 PDB CREDO	0.617	0.159	0.518	0.008
Rv2379c.1	2	3ndx_RIT_A_100 PDB CREDO	0.530	0.272	0.518	0.008
Rv2379c.1	7	1uwh_BAX_A_1723 PDB CREDO	0.617	0.159	0.518	0.008
Rv2379c.2	10	3k2h_LYA_A_514 PDB CREDO	0.583	0.200	0.517	0.008
Rv2379c.2	10	1jkh_EFZ_A_999 PDB CREDO	0.539	0.260	0.517	0.008
Rv2379c.2	11	2jfa_RAL_A_600 PDB CREDO	0.550	0.244	0.516	0.009
Rv2379c.1	2	3n3i_ROC_A_201 PDB CREDO	0.683	0.095	0.515	0.009
Rv2379c.1	7	1hwk_117_D_3 PDB CREDO	0.613	0.164	0.514	0.009
Rv2379c.2	10	3mdz_EZL_A_264 PDB CREDO	0.559	0.232	0.514	0.009
Rv2379c.1	2	1opj_STI_A_3 PDB CREDO	0.681	0.096	0.513	0.009
Rv2379c.1	7	2v0z_C41_C_1328 PDB CREDO	0.635	0.140	0.513	0.009
Rv2379c.2	10	1uof_PNN_A_1312 PDB CREDO	0.534	0.267	0.513	0.009
Rv2379c.1	2	3nu9_478_A_401 PDB CREDO	0.698	0.082	0.512	0.009
Rv2379c.2	11	3oht_1N1_B_1000 PDB CREDO	0.607	0.171	0.512	0.009
Rv2379c.4	6	1a29_TFP_A_153 PDB CREDO	0.547	0.248	0.512	0.009
Rv2379c.1	2	1hsg_MK1_B_902 PDB CREDO	0.643	0.132	0.512	0.009
Rv2379c.2	8	4b7q_ZMR_D_601 PDB CREDO	0.551	0.243	0.512	0.009
Rv2379c.1	7	3pww_ROC_A_1001 PDB CREDO	0.570	0.216	0.512	0.009
Rv2379c.2	10	3g0e_B49_A_9000 PDB CREDO	0.532	0.269	0.511	0.009
Rv2379c.1	2	1opj_STI_B_4 PDB CREDO	0.678	0.099	0.511	0.009
Rv2379c.1	2	2xkw_P1B_A_1478 PDB CREDO	0.578	0.206	0.511	0.009
Rv2379c.1	2	3d20_017_A_201 PDB CREDO	0.548	0.247	0.510	0.009
Rv2379c.2	8	3ckz_ZMR_A_469 PDB CREDO	0.567	0.221	0.510	0.009
Rv2379c.2	10	1fj8_CER_C_500 PDB CREDO	0.532	0.270	0.510	0.009
Rv2379c.2	10	2bxg_IBP_B_2001 PDB CREDO	0.555	0.237	0.510	0.009
Rv2379c.2	10	4cox_IMN_A_701 PDB CREDO	0.555	0.237	0.510	0.009
Rv2379c.1	7	1hwi_115_D_3 PDB CREDO	0.647	0.128	0.510	0.009
Rv2379c.4	6	1nr6_DIF_A_501 PDB CREDO	0.657	0.117	0.510	0.009
Rv2379c.2	10	4cox_IMN_B_701 PDB CREDO	0.554	0.238	0.509	0.009
Rv2379c.2	10	4cox_IMN_C_701 PDB CREDO	0.554	0.238	0.509	0.009
Rv2379c.2	8	2pgf_ADN_A_501 PDB CREDO	0.548	0.247	0.509	0.009
Rv2379c.2	8	3ti5_ZMR_B_1002 PDB CREDO	0.548	0.247	0.509	0.009
Rv2379c.2	11	1qkn_RAL_A_600 PDB CREDO	0.509	0.305	0.509	0.010
Rv2379c.2	10	1fj8_CER_A_500 PDB CREDO	0.530	0.272	0.509	0.010
Rv2379c.2	8	2ya7_ZMR_A_1776 PDB CREDO	0.565	0.224	0.508	0.010
Rv2379c.2	8	2zi9_CL9_A_401 PDB CREDO	0.527	0.277	0.508	0.010
Rv2379c.1	2	3oxw_017_D_200 PDB CREDO	0.674	0.102	0.508	0.010
Rv2379c.2	10	1fj8_CER_D_500 PDB CREDO	0.529	0.274	0.508	0.010
Rv2379c.1	2	3t3c_017_A_201 PDB CREDO	0.655	0.120	0.507	0.010
Rv2379c.2	15	3r9c_ECL_A_451 PDB CREDO	0.507	0.307	0.507	0.010
Rv2379c.2	8	3ti5_ZMR_A_1002 PDB CREDO	0.546	0.250	0.507	0.010
Rv2379c.2	8	1d4f_ADN_C_603 PDB CREDO	0.525	0.280	0.507	0.010
Rv2379c.2	8	2ya7_ZMR_C_1776 PDB CREDO	0.563	0.226	0.507	0.010
Rv2379c.1	2	2q5k_AB1_A_201 PDB CREDO	0.654	0.121	0.507	0.010
Rv2379c.2	8	2pgr_DCF_A_501 PDB CREDO	0.525	0.281	0.506	0.010
Rv2379c.2	8	4b7q_ZMR_A_601 PDB CREDO	0.544	0.252	0.506	0.010
Rv2379c.2	8	4eyb_0WO_B_301 PDB CREDO	0.524	0.282	0.505	0.010
Rv2379c.1	2	3oxw_017_B_200 PDB CREDO	0.670	0.106	0.505	0.010
Rv2379c.1	2	3s53_017_A_201 PDB CREDO	0.670	0.106	0.505	0.010
Rv2379c.2	10	1fkp_NVP_A_999 PDB CREDO	0.527	0.278	0.505	0.010
Rv2379c.2	8	2ya7_ZMR_B_1776 PDB CREDO	0.561	0.229	0.505	0.010
Rv2379c.1	7	3tkd_CYZ_B_267 PDB CREDO	0.601	0.177	0.505	0.010
Rv2379c.2	8	4b7q_ZMR_B_601 PDB CREDO	0.543	0.254	0.505	0.010
Rv2379c.1	7	1hwi_115_B_1 PDB CREDO	0.639	0.135	0.504	0.010
Rv2379c.1	2	2b60_RIT_B_100 PDB CREDO	0.601	0.178	0.504	0.010
Rv2379c.1	2	3em6_017_A_200 PDB CREDO	0.688	0.090	0.504	0.010
Rv2379c.1	2	3lzu_017_A_200 PDB CREDO	0.633	0.142	0.504	0.010
Rv2379c.2	8	1nnc_ZMR_A_479 PDB CREDO	0.563	0.226	0.504	0.010
Rv2379c.2	11	4asd_BAX_A_1500 PDB CREDO	0.607	0.171	0.504	0.010
Rv2379c.1	2	4dqh_017_B_101 PDB CREDO	0.668	0.108	0.503	0.010
Rv2379c.1	2	2rkf_AB1_A_501 PDB CREDO	0.583	0.199	0.503	0.010
Rv2379c.1	2	3ekt_017_D_200 PDB CREDO	0.528	0.276	0.503	0.010
Rv2379c.2	10	1dmy_AZM_A_400 PDB CREDO	0.546	0.250	0.502	0.011
Rv2379c.2	10	1fj8_CER_B_500 PDB CREDO	0.522	0.284	0.501	0.011
Rv2379c.1	2	3h52_486_B_1 PDB CREDO	0.789	0.029	0.500	0.011

Similarity to known drug target from sensitive sequence analysis

No drug targets

List of small molecules tested from TIBLE

Data not available

Off-target activity - ligand based from TIBLE

Data not available

Small molecules involved in protein-protein complex from TIMBAL .Proteins similar to Mtb based on sequence analysis.

Data not available

STITCH interactions

No high confidence interactions