SInCRe - Rv0865

Tuberculist information

Gene name	mog
Protein function	Probable molybdopterin biosynthesis Mog protein
Functional category(tuberculist)	intermediary metabolism and respiration
Gene location(kb)	963.39
Molecular mass(da)	16188.3
External sites	TB Database TubercuList WebTB

Protein sequence

Number of amino acids : 160

	  		  	1    MSTRSARIVVVSSRAAAGVYTDDCGPIIAGWLEQHGFSSVQPQVVADGNPVGEALHDAVN   60
			  	61   AGVDVIITSGGTGISPTDTTPEHTVAVLDYVIPGLADAIRRSGLPKVPTSVLSRGVCGVA  120
			  	121  GRTLIINLPGSPGGVRDGLGVLADVLDHALEQIAGGDHPR

Known structures in the PDB

	PDB ID	2G4R
	Total residue count	480
	Number of chains	3
	Method	X-RAY
	Resolution	1.92

Number of amino acids : 160

Domains assigned based on sequence.

Mtb Structural proteome models

CHOPIN models

Profile-based domain assignment

Structural/Functional domain family	Pfam acc.no./SCOP ID	Domain Region
MoCF_biosynth	PF00994	7-148

Mtb Structural Proteome models

Model Number	1
Model name	Rv0865_2g4r_A
Template	2G4R APDB CREDO
Template coverage	3_155
Template Identity(%)	100.0
Model coverage(%)	95.0
Normalized DOPE score	-2.2

Model Number	2
Model name	Rv0865
Template	2F7W APDB CREDO
Template coverage	2_159
Template Identity(%)	36.4
Model coverage(%)	95.6
Normalized DOPE score	-1.147

Structure Models from Chopin

Model Number	1
Profile	c.57.1.1 - 3.40.980.10 Click for model details
zscore	28.25
Residue begin	1
Residue end	160

Binding pockets

STRING

Cytoscape Web will replace the contents of this div with protein-protein interaction network.

Protein interacting with Rv0865	Gene name	Confidence Score
Rv0864	moaC2	0.995
Rv0438c	moeA2	0.983
Rv0438c	moeA2	0.983
Rv0438c	moeA2	0.983
Rv0866	moaE2	0.966
Rv3111	moaC1	0.965
Rv0869c	moaA2	0.963
Rv0869c	moaA2	0.963
Rv0869c	moaA2	0.963
Rv3324c	moaC3	0.959
Rv0994	moeA1	0.925
Rv0994	moeA1	0.925
Rv0994	moeA1	0.925
Rv3109	moaA1	0.915
Rv3109	moaA1	0.915
Rv3109	moaA1	0.915

Potential ligand/drug binding sites

Protein Model	Pocket Number	Drug Binding Site	PMIN Score	Pvalue PMIN	PMAX Score	Pvalue PMAX
Rv0865_2g4r_A	1	2c49_ADN_A_1301 PDB CREDO	0.684	0.093	0.568	0.004
Rv0865_2g4r_A	1	4e3a_ADN_B_500 PDB CREDO	0.614	0.162	0.551	0.005
Rv0865_2g4r_A	1	3n58_ADN_A_500 PDB CREDO	0.534	0.267	0.534	0.006
Rv0865_2g4r_A	1	3gy3_PNT_A_246 PDB CREDO	0.521	0.287	0.521	0.008
Rv0865_2g4r_A	1	4e3a_ADN_A_500 PDB CREDO	0.685	0.093	0.504	0.010
Rv0865_2g4r_A	1	1fr6_AZR_B_362 PDB CREDO	0.580	0.204	0.501	0.011

Similarity to known drug target from sensitive sequence analysis

No drug targets

List of small molecules tested from TIBLE

Data not available

Off-target activity - ligand based from TIBLE

Data not available

Small molecules involved in protein-protein complex from TIMBAL .Proteins similar to Mtb based on sequence analysis.

Data not available

STITCH interactions

Chemical Name	Confidence score	Molecular Weight
Tris-HClPubChem	0.9	121.135
chloridePubChem	0.9	35.453
molybdenum cofactorPubChem	0.705	522.283