SInCRe - Rv0248c

Tuberculist information

Gene name	Rv0248c
Protein function	Probable succinate dehydrogenase [iron-sulfur subunit] (succinic dehydrogenase)
Functional category(tuberculist)	intermediary metabolism and respiration
Gene location(kb)	298.863
Molecular mass(da)	70680.6
External sites	TB Database TubercuList WebTB

Protein sequence

Number of amino acids : 646

	  		  	1    MVEVERHSYDVVVIGAGGAGLRAVIEARERGLKVAVVCKSLFGKAHTVMAEGGCAAAMGN   60
			  	61   ANPKDNWKTHFGDTMRGGKFLNNWRMAELHAKEAPDRVWELETYGALFDRTDDGRISQRN  120
			  	121  FGGHTYPRLAHVGDRTGLELIRTLQQKVVSLQQEDHAELGDYEARIKVFAECTITELLKD  180
			  	181  QGAIAGAFGYWRESGRFIVFEAPAVVLATGGIGKSFKVTSNSWEYTGDGHALALRAGATL  240
			  	241  INMEFVQFHPTGMVWPPSVKGILVTEGVRGDGGVLKNSENSRFMFDYIPPVFKGQYAETE  300
			  	301  EEADQWLKDNDSARRTPDLLPRDEVARAINSEVKAGRGTPHGGVYLDIASRLTPAEIKRR  360
			  	361  LPSMYHQFKELAEVDITTQAMEVGPTCHYVMGGVEVDADTGAATVPGLFAAGECAGGMHG  420
			  	421  SNRLGGNSLSDLLVFGRRAGLGAADYVRALSSRPAVSAEAIDAAAQQALSPFEGPKDGSA  480
			  	481  PENPYALHMDLQYVMNDLVGIIRNADEISRALTLLAELWSRYHNVLVEGHRQYNPGWNLS  540
			  	541  IDLRNMLLVSECVARAALQRTESRGGHTRDDHPGMDPNWRRILLVCRATETMGTGGSGSG  600
			  	601  DSNCHINVTQQLQTPMRPDLLELFEISELEKYYTDEELAEHPGRRG

Known structures in the PDB

No Known structures

Number of amino acids : 646

Domains assigned based on sequence.

Mtb Structural proteome models

CHOPIN models

Profile-based domain assignment

Structural/Functional domain family	Pfam acc.no./SCOP ID	Domain Region
FAD_binding_2	PF00890	10-429
Succ_DH_flav_C	PF02910	488-596

Mtb Structural Proteome models

Model Number	1
Model name	Rv0248c
Template	1KF6 APDB CREDO
Template coverage	0_572
Template Identity(%)	34.2
Model coverage(%)	93.8
Normalized DOPE score	-0.12

Model Number	2
Model name	Rv0248c.2
Template	1ZOY APDB CREDO
Template coverage	14_621
Template Identity(%)	31.6
Model coverage(%)	99.5
Normalized DOPE score	0.296

Structure Models from Chopin

Model Number	1
Profile	a.7.3.1, d.168.1.1 - 1.20.58.100, 3.50.50.60, 3.90.700.10, 4.10.80.40 Click for model details
zscore	74.75
Residue begin	2
Residue end	631

Model Number	2
Profile	d.168.1.1 Click for model details
zscore	20.55
Residue begin	242
Residue end	394

Model Number	3
Profile	a.7.3.1 Click for model details
zscore	19.39
Residue begin	488
Residue end	596

Model Number	4
Profile	a.7.3.1 Click for model details
zscore	16.1
Residue begin	471
Residue end	618

Model Number	5
Profile	1.20.58.100 Click for model details
zscore	14.54
Residue begin	457
Residue end	577

Model Number	6
Profile	c.3.1.7 Click for model details
zscore	9.97
Residue begin	7
Residue end	207

Binding pockets

STRING

Cytoscape Web will replace the contents of this div with protein-protein interaction network.

Protein interacting with Rv0248c	Gene name	Confidence Score
Rv0247c	Rv0247c	0.993
Rv0247c	Rv0247c	0.993
Rv0951	sucC	0.992
Rv0951	sucC	0.992
Rv0952	sucD	0.992
Rv0952	sucD	0.992
Rv3319	sdhB	0.98
Rv3319	sdhB	0.98
Rv0249c	Rv0249c	0.964
Rv1098c	fum	0.959
Rv1098c	fum	0.959
Rv3316	sdhC	0.908
Rv1553	frdB	0.906
Rv1553	frdB	0.906

Potential ligand/drug binding sites

Protein Model	Pocket Number	Drug Binding Site	PMIN Score	Pvalue PMIN	PMAX Score	Pvalue PMAX
Rv0248c.2	2	2jfa_RAL_A_600 PDB CREDO	0.664	0.111	0.643	0.001
Rv0248c.2	2	1err_RAL_B_600 PDB CREDO	0.664	0.111	0.623	0.001
Rv0248c.2	2	2jfa_RAL_B_600 PDB CREDO	0.661	0.114	0.620	0.001
Rv0248c.2	2	1err_RAL_A_600 PDB CREDO	0.659	0.115	0.619	0.001
Rv0248c.2	2	1qkn_RAL_A_600 PDB CREDO	0.633	0.142	0.613	0.002
Rv0248c.2	2	3oez_STI_B_601 PDB CREDO	0.627	0.148	0.608	0.002
Rv0248c.2	2	2pl0_STI_A_200 PDB CREDO	0.682	0.095	0.602	0.002
Rv0248c.2	2	2fum_MIX_D_3539 PDB CREDO	0.670	0.105	0.587	0.003
Rv0248c.2	2	1uwh_BAX_B_1723 PDB CREDO	0.645	0.130	0.587	0.003
Rv0248c.2	2	1uwh_BAX_A_1723 PDB CREDO	0.644	0.130	0.586	0.003
Rv0248c.2	2	3v5w_8PR_A_701 PDB CREDO	0.604	0.174	0.585	0.003
Rv0248c.2	2	4asd_BAX_A_1500 PDB CREDO	0.681	0.096	0.584	0.003
Rv0248c.2	2	2hyy_STI_B_600 PDB CREDO	0.661	0.114	0.583	0.003
Rv0248c.2	2	2oiq_STI_A_1001 PDB CREDO	0.660	0.115	0.583	0.003
Rv0248c.2	2	2y6o_1N1_A_1892 PDB CREDO	0.581	0.203	0.581	0.003
Rv0248c.2	4	1ynn_RFP_C_1120 PDB CREDO	0.601	0.178	0.580	0.003
Rv0248c.2	2	1t7j_478_A_200 PDB CREDO	0.627	0.148	0.571	0.004
Rv0248c.2	4	2xpv_MIY_A_1209 PDB CREDO	0.571	0.216	0.571	0.004
Rv0248c.2	2	3tne_RIT_A_401 PDB CREDO	0.588	0.194	0.569	0.004
Rv0248c.2	2	3so9_017_A_100 PDB CREDO	0.625	0.151	0.569	0.004
Rv0248c.2	2	3heg_BAX_A_1 PDB CREDO	0.637	0.137	0.563	0.004
Rv0248c.2	2	2gqg_1N1_B_502 PDB CREDO	0.598	0.181	0.561	0.004
Rv0248c.2	2	3bbt_FMM_D_91 PDB CREDO	0.640	0.134	0.561	0.004
Rv0248c.2	2	3oez_STI_A_601 PDB CREDO	0.693	0.086	0.561	0.004
Rv0248c.2	4	3n58_ADN_A_500 PDB CREDO	0.560	0.230	0.560	0.004
Rv0248c.2	2	2fum_MIX_A_539 PDB CREDO	0.709	0.074	0.559	0.004
Rv0248c.2	2	3spk_TPV_A_100 PDB CREDO	0.615	0.162	0.557	0.004
Rv0248c.2	4	1oq5_CEL_A_701 PDB CREDO	0.576	0.209	0.556	0.005
Rv0248c.2	2	1d4s_TPV_A_201 PDB CREDO	0.613	0.164	0.556	0.005
Rv0248c.2	2	1iep_STI_A_201 PDB CREDO	0.686	0.092	0.554	0.005
Rv0248c.2	2	3ms9_STI_B_1 PDB CREDO	0.685	0.093	0.554	0.005
Rv0248c.2	2	3mss_STI_D_1 PDB CREDO	0.685	0.093	0.554	0.005
Rv0248c.2	2	1uwj_BAX_B_1723 PDB CREDO	0.645	0.129	0.553	0.005
Rv0248c.2	2	3mss_STI_B_1 PDB CREDO	0.684	0.094	0.553	0.005
Rv0248c.2	2	1s9p_DES_A_459 PDB CREDO	0.676	0.100	0.552	0.005
Rv0248c.2	2	3ms9_STI_A_1 PDB CREDO	0.682	0.095	0.552	0.005
Rv0248c.2	2	1iep_STI_B_202 PDB CREDO	0.682	0.096	0.551	0.005
Rv0248c.2	2	3gvu_STI_A_1001 PDB CREDO	0.682	0.096	0.551	0.005
Rv0248c.2	2	3pyy_STI_A_3 PDB CREDO	0.681	0.096	0.551	0.005
Rv0248c.2	2	2hyy_STI_C_600 PDB CREDO	0.680	0.097	0.550	0.005
Rv0248c.2	2	3k5v_STI_B_2 PDB CREDO	0.680	0.097	0.550	0.005
Rv0248c.2	2	2hyy_STI_A_600 PDB CREDO	0.680	0.097	0.550	0.005
Rv0248c.2	2	3pyy_STI_B_4 PDB CREDO	0.680	0.097	0.550	0.005
Rv0248c.2	2	2gqg_1N1_A_501 PDB CREDO	0.696	0.084	0.549	0.005
Rv0248c.2	2	2qxs_RAL_A_600 PDB CREDO	0.758	0.043	0.548	0.005
Rv0248c.2	2	3mss_STI_C_1 PDB CREDO	0.678	0.099	0.548	0.005
Rv0248c.2	2	3mss_STI_A_1 PDB CREDO	0.677	0.100	0.547	0.005
Rv0248c.2	2	3ogp_017_A_200 PDB CREDO	0.619	0.157	0.547	0.005
Rv0248c.2	2	1lhv_NOG_A_301 PDB CREDO	0.546	0.250	0.546	0.005
Rv0248c.2	2	1mx1_THA_C_3 PDB CREDO	0.668	0.108	0.546	0.005
Rv0248c.2	2	2hyy_STI_D_600 PDB CREDO	0.674	0.102	0.545	0.005
Rv0248c.2	4	1zgf_TRU_A_300 PDB CREDO	0.630	0.145	0.544	0.006
Rv0248c.2	2	1s9p_DES_D_600 PDB CREDO	0.665	0.110	0.543	0.006
Rv0248c.2	4	1cil_ETS_A_263 PDB CREDO	0.582	0.201	0.543	0.006
Rv0248c.2	2	2qxs_RAL_B_600 PDB CREDO	0.751	0.047	0.543	0.006
Rv0248c.2	4	3bl1_BL1_A_300 PDB CREDO	0.628	0.147	0.542	0.006
Rv0248c.2	2	3k54_1N1_A_1 PDB CREDO	0.709	0.074	0.539	0.006
Rv0248c.2	4	2pou_I7A_A_1000 PDB CREDO	0.623	0.153	0.538	0.006
Rv0248c.2	4	2vke_TAC_A_222 PDB CREDO	0.646	0.129	0.536	0.006
Rv0248c.2	2	1n49_RIT_D_401 PDB CREDO	0.663	0.112	0.536	0.006
Rv0248c.2	2	3hec_STI_A_1 PDB CREDO	0.554	0.239	0.536	0.006
Rv0248c.2	2	3k5v_STI_A_2 PDB CREDO	0.700	0.080	0.535	0.006
Rv0248c.2	4	1hwi_115_C_4 PDB CREDO	0.553	0.239	0.534	0.006
Rv0248c.2	2	2x9g_LYA_A_1270 PDB CREDO	0.534	0.267	0.534	0.006
Rv0248c.2	4	3hku_TOR_A_300 PDB CREDO	0.574	0.212	0.534	0.006
Rv0248c.2	2	3spk_TPV_B_100 PDB CREDO	0.640	0.134	0.533	0.007
Rv0248c.2	4	2xpw_OTC_A_222 PDB CREDO	0.641	0.133	0.533	0.007
Rv0248c.2	2	2hw2_RFP_A_1200 PDB CREDO	0.547	0.248	0.530	0.007
Rv0248c.2	2	1opj_STI_A_3 PDB CREDO	0.713	0.071	0.530	0.007
Rv0248c.2	4	2a69_RPT_M_8002 PDB CREDO	0.588	0.194	0.530	0.007
Rv0248c.2	2	3h52_486_D_2 PDB CREDO	0.582	0.202	0.530	0.007
Rv0248c.2	2	3oct_1N1_A_663 PDB CREDO	0.625	0.150	0.529	0.007
Rv0248c.2	4	4eyb_0WO_A_303 PDB CREDO	0.529	0.274	0.529	0.007
Rv0248c.2	2	3gcs_BAX_A_401 PDB CREDO	0.616	0.160	0.528	0.007
Rv0248c.2	2	3erd_DES_A_600 PDB CREDO	0.669	0.106	0.528	0.007
Rv0248c.2	4	3k2h_LYA_B_514 PDB CREDO	0.527	0.277	0.527	0.007
Rv0248c.2	2	2w8y_486_A_1000 PDB CREDO	0.614	0.162	0.527	0.007
Rv0248c.2	2	1opj_STI_B_4 PDB CREDO	0.709	0.074	0.527	0.007
Rv0248c.2	4	2a69_RPT_C_8001 PDB CREDO	0.587	0.195	0.526	0.007
Rv0248c.2	3	2v0z_C41_O_1327 PDB CREDO	0.553	0.240	0.524	0.008
Rv0248c.2	2	3h52_486_A_3 PDB CREDO	0.576	0.210	0.524	0.008
Rv0248c.2	2	1mx1_THA_E_5 PDB CREDO	0.688	0.090	0.523	0.008
Rv0248c.2	2	3tne_RIT_B_401 PDB CREDO	0.539	0.260	0.522	0.008
Rv0248c.2	2	3erd_DES_B_800 PDB CREDO	0.662	0.113	0.522	0.008
Rv0248c.2	2	1uwj_BAX_A_1723 PDB CREDO	0.664	0.111	0.522	0.008
Rv0248c.2	2	1a28_STR_B_2 PDB CREDO	0.521	0.286	0.521	0.008
Rv0248c.2	2	3oht_1N1_B_1000 PDB CREDO	0.638	0.137	0.521	0.008
Rv0248c.2	2	3cs9_NIL_A_600 PDB CREDO	0.701	0.080	0.521	0.008
Rv0248c.2	4	2trt_TAC_A_222 PDB CREDO	0.676	0.100	0.519	0.008
Rv0248c.2	2	3h52_486_B_1 PDB CREDO	0.587	0.195	0.518	0.008
Rv0248c.2	2	3rgf_BAX_A_465 PDB CREDO	0.658	0.116	0.518	0.008
Rv0248c.2	4	3ce6_ADN_A_500 PDB CREDO	0.577	0.208	0.517	0.008
Rv0248c.2	2	3uvv_T3_A_501 PDB CREDO	0.516	0.294	0.516	0.009
Rv0248c.2	4	1z9y_FUN_A_500 PDB CREDO	0.596	0.184	0.514	0.009
Rv0248c.2	4	3ce6_ADN_B_500 PDB CREDO	0.574	0.212	0.514	0.009
Rv0248c.2	4	3f4x_KLT_A_300 PDB CREDO	0.596	0.184	0.514	0.009
Rv0248c.2	2	3u7s_017_A_202 PDB CREDO	0.514	0.297	0.514	0.009
Rv0248c.2	4	2o7o_DXT_A_222 PDB CREDO	0.668	0.108	0.513	0.009
Rv0248c.2	4	3ce6_ADN_D_500 PDB CREDO	0.572	0.215	0.513	0.009
Rv0248c.2	4	3ce6_ADN_C_500 PDB CREDO	0.571	0.216	0.512	0.009
Rv0248c.2	4	3g1u_ADN_A_438 PDB CREDO	0.641	0.134	0.512	0.009
Rv0248c.2	4	3g1u_ADN_B_438 PDB CREDO	0.641	0.134	0.512	0.009
Rv0248c.2	2	1fm6_BRL_X_504 PDB CREDO	0.512	0.300	0.512	0.009
Rv0248c.2	4	3g1u_ADN_C_438 PDB CREDO	0.570	0.216	0.511	0.009
Rv0248c.2	2	2aoh_FRD_C_305 PDB CREDO	0.579	0.206	0.511	0.009
Rv0248c.2	3	2v0z_C41_C_1328 PDB CREDO	0.582	0.201	0.511	0.009
Rv0248c.2	2	1xzx_T3_X_500 PDB CREDO	0.511	0.301	0.511	0.009
Rv0248c.2	4	3n58_ADN_D_500 PDB CREDO	0.570	0.217	0.511	0.009
Rv0248c.2	4	1hwi_115_A_2 PDB CREDO	0.585	0.197	0.510	0.009
Rv0248c.2	2	1nhz_486_A_800 PDB CREDO	0.563	0.226	0.510	0.009
Rv0248c.2	2	3q70_RIT_A_2001 PDB CREDO	0.577	0.208	0.510	0.009
Rv0248c.2	2	3d91_REM_B_350 PDB CREDO	0.593	0.187	0.509	0.010
Rv0248c.2	2	3d91_REM_A_350 PDB CREDO	0.592	0.188	0.508	0.010
Rv0248c.2	2	3cs9_NIL_B_600 PDB CREDO	0.702	0.079	0.508	0.010
Rv0248c.2	2	1bsx_T3_A_1 PDB CREDO	0.524	0.281	0.507	0.010
Rv0248c.2	2	1bsx_T3_B_2 PDB CREDO	0.524	0.281	0.507	0.010
Rv0248c.2	2	2r5q_1UN_D_900 PDB CREDO	0.609	0.168	0.507	0.010
Rv0248c.2	2	1t46_STI_A_3 PDB CREDO	0.739	0.054	0.507	0.010
Rv0248c.2	2	2fxd_DR7_A_102 PDB CREDO	0.719	0.067	0.506	0.010
Rv0248c.2	2	3ogp_017_B_200 PDB CREDO	0.625	0.150	0.506	0.010
Rv0248c.2	2	2r5q_1UN_B_900 PDB CREDO	0.607	0.171	0.505	0.010
Rv0248c.2	4	4eyb_0WO_B_301 PDB CREDO	0.543	0.254	0.505	0.010
Rv0248c.2	2	1n49_RIT_B_301 PDB CREDO	0.679	0.098	0.505	0.010
Rv0248c.2	2	3bbt_FMM_B_91 PDB CREDO	0.714	0.070	0.504	0.010
Rv0248c.2	4	3znc_BZ1_A_500 PDB CREDO	0.583	0.199	0.504	0.010
Rv0248c.2	2	3lzv_017_A_200 PDB CREDO	0.659	0.116	0.504	0.010
Rv0248c.2	2	1jg2_ADN_A_500 PDB CREDO	0.595	0.185	0.503	0.010
Rv0248c.2	2	2h42_VIA_A_901 PDB CREDO	0.575	0.211	0.503	0.010
Rv0248c.2	4	2a68_RBT_C_8001 PDB CREDO	0.521	0.285	0.503	0.010
Rv0248c.2	2	3mne_DEX_A_784 PDB CREDO	0.519	0.289	0.503	0.010
Rv0248c.2	2	3el0_1UN_A_201 PDB CREDO	0.656	0.118	0.502	0.011
Rv0248c.2	2	3h0a_9RA_A_500 PDB CREDO	0.572	0.214	0.501	0.011
Rv0248c.2	2	3cs9_NIL_C_600 PDB CREDO	0.731	0.059	0.501	0.011
Rv0248c.2	2	3u7s_017_A_201 PDB CREDO	0.553	0.240	0.501	0.011

Similarity to known drug target from sensitive sequence analysis

DrugBank ID	Drug Name
DB00730DrugBank	Thiabendazole

List of small molecules tested from TIBLE

Data not available

Off-target activity - ligand based from TIBLE

Data not available

Small molecules involved in protein-protein complex from TIMBAL .Proteins similar to Mtb based on sequence analysis.

Data not available

STITCH interactions

Chemical Name	Confidence score	Molecular Weight
succinatePubChem	0.919	118.088
fumaratePubChem	0.914	116.072