Rv3808c
Tuberculist information
| Gene name | glfT2 |
| Protein function | Bifunctional UDP-galactofuranosyl transferase GlfT2 |
| Functional category(tuberculist) | cell wall and cell processes |
| Gene location(kb) | 4270.37 |
| Molecular mass(da) | 71506.5 |
| External sites | TB Database TubercuList WebTB |
|---|
Protein sequence
Number of amino acids : 637
1 MSELAASLLSRVILPRPGEPLDVRKLYLEESTTNARRAHAPTRTSLQIGAESEVSFATYF 60 61 NAFPASYWRRWTTCKSVVLRVQVTGAGRVDVYRTKATGARIFVEGHDFTGTEDQPAAVET 120 121 EVVLQPFEDGGWVWFDITTDTAVTLHSGGWYATSPAPGTANIAVGIPTFNRPADCVNALR 180 181 ELTADPLVDQVIGAVIVPDQGERKVRDHPDFPAAAARLGSRLSIHDQPNLGGSGGYSRVM 240 241 YEALKNTDCQQILFMDDDIRLEPDSILRVLAMHRFAKAPMLVGGQMLNLQEPSHLHIMGE 300 301 VVDRSIFMWTAAPHAEYDHDFAEYPLNDNNSRSKLLHRRIDVDYNGWWTCMIPRQVAEEL 360 361 GQPLPLFIKWDDADYGLRAAEHGYPTVTLPGAAIWHMAWSDKDDAIDWQAYFHLRNRLVV 420 421 AAMHWDGPKAQVIGLVRSHLKATLKHLACLEYSTVAIQNKAIDDFLAGPEHIFSILESAL 480 481 PQVHRIRKSYPDAVVLPAASELPPPLHKNKAMKPPVNPLVIGYRLARGIMHNLTAANPQH 540 541 HRRPEFNVPTQDARWFLLCTVDGATVTTADGCGVVYRQRDRAKMFALLWQSLRRQRQLLK 600 601 RFEEMRRIYRDALPTLSSKQKWETALLPAANQEPEHG
Number of amino acids : 637
Domains assigned based on sequence.
Mtb Structural proteome models
CHOPIN models
Domains assigned based on sequence. Mtb Structural proteome models CHOPIN models| Structural/Functional domain family | Pfam acc.no./SCOP ID | Domain Region | |
|---|---|---|---|
| Glyco_tranf_2_3 | PF13641 | 160-421 |
| Model Number | 1 |
| Profile | c.68.1.1 - 3.90.550.10 Click for model details |
|---|---|
| zscore | 9.25 |
| Residue begin | 160 |
| Residue end | 395 |
Cytoscape Web will replace the contents of this div with protein-protein interaction network.
| Protein interacting with Rv3808c | Gene name | Confidence Score |
|---|---|---|
| Rv3809c | glf | 0.984 |
| Rv3809c | glf | 0.984 |
| Rv3782 | glfT1 | 0.966 |
| Rv3806c | ubiA | 0.956 |
| Rv3795 | embB | 0.93 |
| Rv3795 | embB | 0.93 |
| Rv3805c | aftB | 0.92 |
| Rv3783 | rfbD | 0.903 |
| Rv3794 | embA | 0.902 |
| Rv3794 | embA | 0.902 |
View results in TIBLE page
| Name | Affinity | Assay description | DOI |
|---|---|---|---|
| CHEMBL1090322 | Inhibition = 0 % | Inhibition of Mycobacterium tuberculosis GlfT2 assessed as incorporation of [14C]Gal at 1 mM by scintillation counting | http://www.ncbi.nlm.nih.gov/pubmed/20226679 |
| CHEMBL1090323 | Inhibition = 0 % | Inhibition of Mycobacterium tuberculosis GlfT2 assessed as incorporation of [14C]Gal at 1 mM by scintillation counting | http://www.ncbi.nlm.nih.gov/pubmed/20226679 |
| CHEMBL1090324 | Inhibition = 0 % | Inhibition of Mycobacterium tuberculosis GlfT2 assessed as incorporation of [14C]Gal at 1 mM by scintillation counting | http://www.ncbi.nlm.nih.gov/pubmed/20226679 |
| CHEMBL1090326 | Inhibition = 0 % | Inhibition of Mycobacterium tuberculosis GlfT2 assessed as incorporation of [14C]Gal at 1 mM by scintillation counting | http://www.ncbi.nlm.nih.gov/pubmed/20226679 |
| CHEMBL1090327 | Inhibition = 0 % | Inhibition of Mycobacterium tuberculosis GlfT2 assessed as incorporation of [14C]Gal at 1 mM by scintillation counting | http://www.ncbi.nlm.nih.gov/pubmed/20226679 |
| CHEMBL1090660 | Inhibition = 80 % | Inhibition of Mycobacterium tuberculosis GlfT2 assessed as incorporation of [14C]Gal at 1 mM by scintillation counting | http://www.ncbi.nlm.nih.gov/pubmed/20226679 |
| CHEMBL1090661 | Inhibition = 0 % | Inhibition of Mycobacterium tuberculosis GlfT2 assessed as incorporation of [14C]Gal at 1 mM by scintillation counting | http://www.ncbi.nlm.nih.gov/pubmed/20226679 |
| CHEMBL1090663 | Inhibition = 0 % | Inhibition of Mycobacterium tuberculosis GlfT2 assessed as incorporation of [14C]Gal at 1 mM by scintillation counting | http://www.ncbi.nlm.nih.gov/pubmed/20226679 |
| CHEMBL1090665 | Inhibition = 0 % | Inhibition of Mycobacterium tuberculosis GlfT2 assessed as incorporation of [14C]Gal at 1 mM by scintillation counting | http://www.ncbi.nlm.nih.gov/pubmed/20226679 |
| CHEMBL1090666 | Inhibition = 0 % | Inhibition of Mycobacterium tuberculosis GlfT2 assessed as incorporation of [14C]Gal at 1 mM by scintillation counting | http://www.ncbi.nlm.nih.gov/pubmed/20226679 |
| CHEMBL1090667 | Inhibition = 0 % | Inhibition of Mycobacterium tuberculosis GlfT2 assessed as incorporation of [14C]Gal at 1 mM by scintillation counting | http://www.ncbi.nlm.nih.gov/pubmed/20226679 |
| CHEMBL1090668 | Inhibition = 0 % | Inhibition of Mycobacterium tuberculosis GlfT2 assessed as incorporation of [14C]Gal at 1 mM by scintillation counting | http://www.ncbi.nlm.nih.gov/pubmed/20226679 |
| CHEMBL1090669 | Inhibition = 0 % | Inhibition of Mycobacterium tuberculosis GlfT2 assessed as incorporation of [14C]Gal at 1 mM by scintillation counting | http://www.ncbi.nlm.nih.gov/pubmed/20226679 |
| CHEMBL1091000 | Inhibition = 0 % | Inhibition of Mycobacterium tuberculosis GlfT2 assessed as incorporation of [14C]Gal at 1 mM by scintillation counting | http://www.ncbi.nlm.nih.gov/pubmed/20226679 |
| CHEMBL1644888 | Inhibition = 11 % | Inhibition of Mycobacterium tuberculosis GIFT2 at 4 mM at pH7.6 by spectrophotometric assay | http://www.ncbi.nlm.nih.gov/pubmed/21167722 |
| CHEMBL1644889 | Inhibition < 10 % | Inhibition of Mycobacterium tuberculosis GIFT2 at 4 mM at pH7.6 by spectrophotometric assay | http://www.ncbi.nlm.nih.gov/pubmed/21167722 |
| CHEMBL1644890 | Inhibition = 75 % | Inhibition of Mycobacterium tuberculosis GIFT2 at 4 mM at pH7.6 by spectrophotometric assay | http://www.ncbi.nlm.nih.gov/pubmed/21167722 |
| CHEMBL1644891 | IC50 = 332 uM | Inhibition of Mycobacterium tuberculosis GIFT2 at pH7.6 by spectrophotometric assay | http://www.ncbi.nlm.nih.gov/pubmed/21167722 |
| CHEMBL1644891 | Inhibition = 79 % | Inhibition of Mycobacterium tuberculosis GIFT2 at 4 mM at pH7.6 by spectrophotometric assay | http://www.ncbi.nlm.nih.gov/pubmed/21167722 |
| CHEMBL1644892 | Inhibition < 10 % | Inhibition of Mycobacterium tuberculosis GIFT2 at 4 mM at pH7.6 by spectrophotometric assay | http://www.ncbi.nlm.nih.gov/pubmed/21167722 |
| CHEMBL1644893 | Inhibition < 10 % | Inhibition of Mycobacterium tuberculosis GIFT2 at 4 mM at pH7.6 by spectrophotometric assay | http://www.ncbi.nlm.nih.gov/pubmed/21167722 |
| CHEMBL1644894 | Inhibition = 53 % | Inhibition of Mycobacterium tuberculosis GIFT2 at 4 mM at pH7.6 by spectrophotometric assay | http://www.ncbi.nlm.nih.gov/pubmed/21167722 |
| CHEMBL1644895 | Inhibition = 18 % | Inhibition of Mycobacterium tuberculosis GIFT2 at 4 mM at pH7.6 by spectrophotometric assay | http://www.ncbi.nlm.nih.gov/pubmed/21167722 |
| CHEMBL1644896 | Inhibition < 10 % | Inhibition of Mycobacterium tuberculosis GIFT2 at 2 mM at pH7.6 by spectrophotometric assay | http://www.ncbi.nlm.nih.gov/pubmed/21167722 |
| CHEMBL1644897 | Inhibition = 14 % | Inhibition of Mycobacterium tuberculosis GIFT2 at 2 mM at pH7.6 by spectrophotometric assay | http://www.ncbi.nlm.nih.gov/pubmed/21167722 |
| CHEMBL1644898 | Inhibition = 30 % | Inhibition of Mycobacterium tuberculosis GIFT2 at 2 mM at pH7.6 by spectrophotometric assay | http://www.ncbi.nlm.nih.gov/pubmed/21167722 |
| CHEMBL1644899 | Inhibition = 37 % | Inhibition of Mycobacterium tuberculosis GIFT2 at 2 mM at pH7.6 by spectrophotometric assay | http://www.ncbi.nlm.nih.gov/pubmed/21167722 |
| CHEMBL1644900 | Inhibition < 10 % | Inhibition of Mycobacterium tuberculosis GIFT2 at 2 mM at pH7.6 by spectrophotometric assay | http://www.ncbi.nlm.nih.gov/pubmed/21167722 |
| CHEMBL1644901 | Inhibition < 10 % | Inhibition of Mycobacterium tuberculosis GIFT2 at 2 mM at pH7.6 by spectrophotometric assay | http://www.ncbi.nlm.nih.gov/pubmed/21167722 |
| CHEMBL1644902 | Inhibition < 10 % | Inhibition of Mycobacterium tuberculosis GIFT2 at 2 mM at pH7.6 by spectrophotometric assay | http://www.ncbi.nlm.nih.gov/pubmed/21167722 |
| CHEMBL1644903 | Inhibition < 10 % | Inhibition of Mycobacterium tuberculosis GIFT2 at 2 mM at pH7.6 by spectrophotometric assay | http://www.ncbi.nlm.nih.gov/pubmed/21167722 |
View results in TIBLE page
| Predicted off-target | Method | Summary | Full results |
|---|---|---|---|
| chitin synthase 1; chitin-UDP acetyl-glucosaminyl transferase 1; Class-I chitin synthase 1 [-] | SEA | E_value = 2.04e-57 & MaxTC = 0.49 | Link |
| phospho-N-acetylmuramoyl-pentapeptide-transferase [-] | SEA | E_value = 7.25e-48 & MaxTC = 0.51 | Link |
| DNA beta-glucosyltransferase [-] | SEA | E_value = 2.73e-45 & MaxTC = 0.41 | Link |
| uridine phosphorylase | SEA | E_value = 6.72e-37 & MaxTC = 0.5 | Link |
| P2Y purinoceptor 2; ATP receptor [+] | SEA | E_value = 7.15e-26 & MaxTC = 0.4 | Link |
| P2Y purinoceptor 6; ATP receptor [+] | SEA | E_value = 3.13e-18 & MaxTC = 0.41 | Link |
| UDP-N-acetylglucosamine transporter; Golgi UDP-GlcNAc transporter [-] | SEA | E_value = 4.22e-18 & MaxTC = 0.41 | Link |
| Thymidine kinase; cytosolic | SEA | E_value = 2.81e-15 & MaxTC = 0.31 | Link |
Data not available
