SInCRe - Rv3806c

Tuberculist information

Gene name	ubiA
Protein function	Decaprenylphosphoryl-5-phosphoribose (DPPR) synthase (decaprenyl-phosphate 5-phosphoribosyltransferase)
Functional category(tuberculist)	cell wall and cell processes
Gene location(kb)	4268.92
Molecular mass(da)	32654.5
External sites	TB Database TubercuList WebTB

Protein sequence

Number of amino acids : 302

	  		  	1    MSEDVVTQPPANLVAGVVKAIRPRQWVKNVLVLAAPLAALGGGVRYDYVEVLSKVSMAFV   60
			  	61   VFSLAASAVYLVNDVRDVEADREHPTKRFRPIAAGVVPEWLAYTVAVVLGVTSLAGAWML  120
			  	121  TPNLALVMVVYLAMQLAYCFGLKHQAVVEICVVSSAYLIRAIAGGVATKIPLSKWFLLIM  180
			  	181  AFGSLFMVAGKRYAELHLAERTGAAIRKSLESYTSTYLRFVWTLSATAVVLCYGLWAFER  240
			  	241  DGYSGSWFAVSMIPFTIAILRYAVDVDGGLAGEPEDIALRDRVLQLLALAWIATVGAAVA  300
			  	301  FG

Known structures in the PDB

No Known structures

Number of amino acids : 302

Domains assigned based on sequence.

Mtb Structural proteome models

CHOPIN models

Profile-based domain assignment

Structural/Functional domain family	Pfam acc.no./SCOP ID	Domain Region
UbiA	PF01040	29-300

Mtb Structural Proteome models

Model Number	1
Model name	Rv3806c
Template	1XME APDB CREDO
Template coverage	14_209
Template Identity(%)	17.9
Model coverage(%)	66.9
Normalized DOPE score	0.834

Model Number	2
Model name	Rv3806c.1
Template	1WPG APDB CREDO
Template coverage	751_979
Template Identity(%)	12.8
Model coverage(%)	58.9
Normalized DOPE score	1.067

Structure Models from Chopin

Model Number	1
Profile	f.46.1.1 Click for model details
zscore	4.2
Residue begin
Residue end

Binding pockets

STRING

Cytoscape Web will replace the contents of this div with protein-protein interaction network.

Protein interacting with Rv3806c	Gene name	Confidence Score
Rv3790	dprE1	0.993
Rv3790	dprE1	0.993
Rv3791	dprE2	0.985
Rv3807c	Rv3807c	0.975
Rv3808c	glfT2	0.956
Rv3805c	aftB	0.931
Rv3809c	glf	0.922
Rv3809c	glf	0.922
Rv2073c	Rv2073c	0.916

Potential ligand/drug binding sites

Protein Model	Pocket Number	Drug Binding Site	PMIN Score	Pvalue PMIN	PMAX Score	Pvalue PMAX
Rv3806c.1	1	1mx1_THA_B_2 PDB CREDO	0.661	0.114	0.661	0.001
Rv3806c.1	4	1ya4_CTX_A_1 PDB CREDO	0.697	0.083	0.648	0.001
Rv3806c.1	4	2xkw_P1B_A_1478 PDB CREDO	0.656	0.119	0.639	0.001
Rv3806c.1	1	1xp0_VDN_A_201 PDB CREDO	0.695	0.085	0.639	0.001
Rv3806c.1	1	2w8y_NDR_B_1000 PDB CREDO	0.687	0.091	0.634	0.001
Rv3806c.1	1	1fko_EFZ_A_999 PDB CREDO	0.657	0.118	0.630	0.001
Rv3806c.1	1	3lp0_NVP_A_701 PDB CREDO	0.653	0.121	0.627	0.001
Rv3806c.1	1	3lp1_NVP_A_701 PDB CREDO	0.650	0.125	0.623	0.001
Rv3806c.1	4	2qxs_RAL_A_600 PDB CREDO	0.727	0.062	0.621	0.001
Rv3806c.1	4	3gp0_NIL_A_1 PDB CREDO	0.669	0.107	0.619	0.001
Rv3806c.1	4	2qxs_RAL_B_600 PDB CREDO	0.724	0.064	0.619	0.001
Rv3806c.1	1	3b2r_VDN_B_1 PDB CREDO	0.733	0.058	0.617	0.002
Rv3806c.1	1	1tbf_VIA_A_501 PDB CREDO	0.762	0.041	0.613	0.002
Rv3806c.1	1	3nt1_NPS_B_4 PDB CREDO	0.639	0.136	0.613	0.002
Rv3806c.1	1	3nt1_NPS_A_5 PDB CREDO	0.638	0.137	0.612	0.002
Rv3806c.1	1	1mx1_THA_D_4 PDB CREDO	0.662	0.113	0.611	0.002
Rv3806c.1	1	3b2r_VDN_A_1 PDB CREDO	0.725	0.063	0.611	0.002
Rv3806c.1	1	1mx1_THA_F_6 PDB CREDO	0.661	0.114	0.609	0.002
Rv3806c.1	1	1s9p_DES_B_459 PDB CREDO	0.661	0.114	0.609	0.002
Rv3806c.1	1	1mx1_THA_A_1 PDB CREDO	0.634	0.141	0.608	0.002
Rv3806c.1	1	1s9p_DES_C_500 PDB CREDO	0.658	0.117	0.607	0.002
Rv3806c.1	1	1g50_EST_A_600 PDB CREDO	0.632	0.143	0.607	0.002
Rv3806c.1	1	3n8z_FLP_B_1701 PDB CREDO	0.632	0.143	0.607	0.002
Rv3806c.1	1	1dtl_BEP_A_205 PDB CREDO	0.604	0.175	0.604	0.002
Rv3806c.1	1	2yja_EST_B_1550 PDB CREDO	0.628	0.147	0.603	0.002
Rv3806c.1	1	3uud_EST_A_600 PDB CREDO	0.627	0.149	0.602	0.002
Rv3806c.1	1	2ayl_FLP_B_2701 PDB CREDO	0.600	0.179	0.600	0.002
Rv3806c.1	1	1gs4_ZK5_A_1918 PDB CREDO	0.786	0.030	0.600	0.002
Rv3806c.1	1	3ols_EST_B_600 PDB CREDO	0.625	0.150	0.600	0.002
Rv3806c.1	1	3uud_EST_B_600 PDB CREDO	0.625	0.150	0.600	0.002
Rv3806c.1	1	1eqh_FLP_A_701 PDB CREDO	0.648	0.126	0.596	0.002
Rv3806c.1	1	3ols_EST_A_600 PDB CREDO	0.620	0.156	0.595	0.002
Rv3806c.1	1	1eqh_FLP_B_1701 PDB CREDO	0.647	0.128	0.594	0.002
Rv3806c.1	1	1xoz_CIA_A_501 PDB CREDO	0.739	0.054	0.594	0.002
Rv3806c.1	1	1cqe_FLP_A_1650 PDB CREDO	0.645	0.130	0.593	0.002
Rv3806c.1	1	1cqe_FLP_B_2650 PDB CREDO	0.641	0.133	0.589	0.003
Rv3806c.1	1	1ya4_CTX_C_3 PDB CREDO	0.639	0.136	0.589	0.003
Rv3806c.1	1	1ya4_CTX_B_2 PDB CREDO	0.638	0.137	0.588	0.003
Rv3806c.1	1	2j7y_E3O_A_1454 PDB CREDO	0.689	0.090	0.588	0.003
Rv3806c.1	1	3erd_DES_A_600 PDB CREDO	0.769	0.038	0.587	0.003
Rv3806c.1	1	1lwf_NVP_A_999 PDB CREDO	0.612	0.165	0.587	0.003
Rv3806c.1	1	3n8y_DIF_B_585 PDB CREDO	0.761	0.042	0.584	0.003
Rv3806c.1	1	2hny_NVP_A_999 PDB CREDO	0.607	0.170	0.582	0.003
Rv3806c.1	1	3qip_NVP_A_561 PDB CREDO	0.606	0.171	0.582	0.003
Rv3806c.1	1	3pgh_FLP_D_701 PDB CREDO	0.631	0.144	0.580	0.003
Rv3806c.1	1	1dtl_BEP_A_204 PDB CREDO	0.601	0.178	0.577	0.003
Rv3806c.1	1	1lwc_NVP_A_999 PDB CREDO	0.601	0.178	0.577	0.003
Rv3806c.1	1	1g50_EST_C_2600 PDB CREDO	0.626	0.149	0.576	0.003
Rv3806c.1	1	3oll_EST_B_600 PDB CREDO	0.626	0.149	0.576	0.003
Rv3806c.1	1	3oll_EST_A_600 PDB CREDO	0.625	0.150	0.575	0.003
Rv3806c.1	1	1a52_EST_A_1 PDB CREDO	0.623	0.153	0.572	0.003
Rv3806c.1	1	1pcg_EST_A_1 PDB CREDO	0.623	0.153	0.572	0.003
Rv3806c.1	1	3lfa_1N1_A_361 PDB CREDO	0.597	0.183	0.572	0.003
Rv3806c.1	1	3adx_IMN_B_3 PDB CREDO	0.596	0.184	0.572	0.003
Rv3806c.1	4	1xkk_FMM_A_91 PDB CREDO	0.602	0.177	0.572	0.003
Rv3806c.1	1	2j7x_EST_A_1454 PDB CREDO	0.622	0.154	0.571	0.004
Rv3806c.1	1	2hnd_NVP_A_999 PDB CREDO	0.595	0.185	0.571	0.004
Rv3806c.1	1	1ere_EST_D_600 PDB CREDO	0.620	0.156	0.570	0.004
Rv3806c.1	1	1s9p_DES_D_600 PDB CREDO	0.772	0.036	0.569	0.004
Rv3806c.1	1	1a52_EST_B_2 PDB CREDO	0.619	0.157	0.569	0.004
Rv3806c.1	1	1ere_EST_C_600 PDB CREDO	0.619	0.157	0.569	0.004
Rv3806c.1	1	3hm1_J3Z_B_1 PDB CREDO	0.619	0.157	0.569	0.004
Rv3806c.1	1	1ere_EST_F_600 PDB CREDO	0.618	0.158	0.568	0.004
Rv3806c.1	1	2ayl_FLP_A_1701 PDB CREDO	0.640	0.134	0.568	0.004
Rv3806c.1	1	1sqn_NDR_A_1001 PDB CREDO	0.768	0.038	0.566	0.004
Rv3806c.1	1	2ocf_EST_A_596 PDB CREDO	0.615	0.161	0.565	0.004
Rv3806c.1	1	1sqn_NDR_B_2001 PDB CREDO	0.767	0.039	0.565	0.004
Rv3806c.1	1	1mx1_THA_E_5 PDB CREDO	0.712	0.072	0.564	0.004
Rv3806c.1	1	3h0a_9RA_A_500 PDB CREDO	0.819	0.018	0.563	0.004
Rv3806c.1	4	3ucb_017_A_201 PDB CREDO	0.621	0.155	0.563	0.004
Rv3806c.1	4	3ogq_AB1_A_200 PDB CREDO	0.577	0.208	0.563	0.004
Rv3806c.1	1	1qkt_EST_A_600 PDB CREDO	0.611	0.166	0.562	0.004
Rv3806c.1	4	3cs9_NIL_B_600 PDB CREDO	0.657	0.118	0.561	0.004
Rv3806c.1	1	3bbt_FMM_B_91 PDB CREDO	0.657	0.117	0.561	0.004
Rv3806c.1	4	3cs9_NIL_A_600 PDB CREDO	0.674	0.102	0.561	0.004
Rv3806c.1	4	3cs9_NIL_C_600 PDB CREDO	0.621	0.154	0.560	0.004
Rv3806c.1	1	3n8z_FLP_A_701 PDB CREDO	0.656	0.118	0.560	0.004
Rv3806c.1	1	1s9p_DES_A_459 PDB CREDO	0.760	0.042	0.560	0.004
Rv3806c.1	1	1a27_EST_A_350 PDB CREDO	0.631	0.144	0.560	0.004
Rv3806c.1	1	3pgh_FLP_C_701 PDB CREDO	0.693	0.086	0.558	0.004
Rv3806c.1	4	3b0w_DGX_B_1 PDB CREDO	0.689	0.090	0.557	0.004
Rv3806c.1	4	3cs9_NIL_D_600 PDB CREDO	0.617	0.159	0.557	0.004
Rv3806c.1	4	3ufn_ROC_A_401 PDB CREDO	0.601	0.178	0.556	0.005
Rv3806c.1	1	1fk9_EFZ_A_999 PDB CREDO	0.601	0.178	0.555	0.005
Rv3806c.1	1	1lw0_NVP_A_999 PDB CREDO	0.599	0.180	0.553	0.005
Rv3806c.1	1	1fkp_NVP_A_999 PDB CREDO	0.575	0.210	0.552	0.005
Rv3806c.1	1	3h52_486_C_4 PDB CREDO	0.721	0.066	0.551	0.005
Rv3806c.1	1	1jkh_EFZ_A_999 PDB CREDO	0.574	0.212	0.550	0.005
Rv3806c.1	1	2fum_MIX_B_1539 PDB CREDO	0.569	0.218	0.546	0.005
Rv3806c.1	1	3tmz_06X_A_503 PDB CREDO	0.590	0.191	0.543	0.006
Rv3806c.1	1	2zva_1N1_A_513 PDB CREDO	0.588	0.194	0.542	0.006
Rv3806c.1	4	3sm2_478_A_126 PDB CREDO	0.539	0.259	0.539	0.006
Rv3806c.1	4	2pym_1UN_A_1001 PDB CREDO	0.553	0.240	0.539	0.006
Rv3806c.1	4	2q64_1UN_B_1001 PDB CREDO	0.553	0.240	0.539	0.006
Rv3806c.1	4	2qak_1UN_A_1001 PDB CREDO	0.553	0.240	0.539	0.006
Rv3806c.1	4	2pyn_1UN_A_1001 PDB CREDO	0.551	0.242	0.538	0.006
Rv3806c.1	1	3vkx_T3_A_301 PDB CREDO	0.734	0.057	0.537	0.006
Rv3806c.1	4	2q63_1UN_A_1001 PDB CREDO	0.551	0.243	0.537	0.006
Rv3806c.1	3	3ucb_017_A_201 PDB CREDO	0.645	0.130	0.537	0.006
Rv3806c.1	3	3oxc_ROC_A_401 PDB CREDO	0.547	0.248	0.535	0.006
Rv3806c.1	1	1udu_CIA_B_2003 PDB CREDO	0.582	0.201	0.535	0.006
Rv3806c.1	1	3erd_DES_B_800 PDB CREDO	0.700	0.081	0.534	0.006
Rv3806c.1	1	2h42_VIA_C_903 PDB CREDO	0.699	0.082	0.534	0.006
Rv3806c.1	3	1k6c_MK1_B_902 PDB CREDO	0.625	0.150	0.533	0.007
Rv3806c.1	4	3gcs_BAX_A_401 PDB CREDO	0.739	0.054	0.533	0.007
Rv3806c.1	1	3pgh_FLP_B_701 PDB CREDO	0.662	0.113	0.532	0.007
Rv3806c.1	3	3gp0_NIL_A_1 PDB CREDO	0.761	0.042	0.532	0.007
Rv3806c.1	1	1s1u_NVP_A_999 PDB CREDO	0.554	0.238	0.531	0.007
Rv3806c.1	4	2f80_017_B_301 PDB CREDO	0.544	0.252	0.531	0.007
Rv3806c.1	1	3hvt_NVP_A_557 PDB CREDO	0.552	0.241	0.530	0.007
Rv3806c.1	1	1mrl_DOL_A_300 PDB CREDO	0.551	0.242	0.529	0.007
Rv3806c.1	1	1eqg_IBP_B_1701 PDB CREDO	0.654	0.120	0.526	0.007
Rv3806c.1	1	3sxr_1N1_A_1 PDB CREDO	0.571	0.216	0.526	0.007
Rv3806c.1	1	2q1v_PDN_A_248 PDB CREDO	0.739	0.054	0.526	0.007
Rv3806c.1	1	1fdu_EST_C_353 PDB CREDO	0.593	0.188	0.526	0.007
Rv3806c.1	1	1jlb_NVP_A_999 PDB CREDO	0.624	0.151	0.526	0.007
Rv3806c.1	1	2gqg_1N1_A_501 PDB CREDO	0.688	0.090	0.525	0.007
Rv3806c.1	4	3heg_BAX_A_1 PDB CREDO	0.750	0.048	0.525	0.007
Rv3806c.1	1	1cqp_803_B_311 PDB CREDO	0.652	0.122	0.525	0.007
Rv3806c.1	1	1mx1_THA_C_3 PDB CREDO	0.711	0.073	0.524	0.008
Rv3806c.1	1	3axz_ADN_A_401 PDB CREDO	0.595	0.185	0.524	0.008
Rv3806c.1	1	3tbg_RTZ_A_1 PDB CREDO	0.546	0.249	0.524	0.008
Rv3806c.1	1	3clb_TMQ_B_612 PDB CREDO	0.650	0.124	0.523	0.008
Rv3806c.1	1	3hbb_TMQ_C_613 PDB CREDO	0.594	0.186	0.523	0.008
Rv3806c.1	1	1nhz_486_A_800 PDB CREDO	0.787	0.030	0.523	0.008
Rv3806c.1	1	3sxr_1N1_B_2 PDB CREDO	0.544	0.252	0.522	0.008
Rv3806c.1	1	1gwr_EST_A_600 PDB CREDO	0.649	0.125	0.522	0.008
Rv3806c.1	1	1eqg_IBP_A_701 PDB CREDO	0.648	0.126	0.521	0.008
Rv3806c.1	1	3hm1_J3Z_A_2 PDB CREDO	0.648	0.126	0.521	0.008
Rv3806c.1	4	3bjw_SVR_B_501 PDB CREDO	0.548	0.247	0.521	0.008
Rv3806c.1	1	1g50_EST_B_1600 PDB CREDO	0.647	0.127	0.520	0.008
Rv3806c.1	1	3clb_TMQ_A_611 PDB CREDO	0.591	0.190	0.520	0.008
Rv3806c.1	4	3oxx_DR7_A_100 PDB CREDO	0.520	0.287	0.520	0.008
Rv3806c.1	3	1rl8_RIT_A_9001 PDB CREDO	0.656	0.119	0.520	0.008
Rv3806c.1	1	3vri_1KX_A_301 PDB CREDO	0.564	0.225	0.520	0.008
Rv3806c.1	1	1qku_EST_A_600 PDB CREDO	0.646	0.129	0.520	0.008
Rv3806c.1	1	3jwq_VIA_C_901 PDB CREDO	0.783	0.031	0.520	0.008
Rv3806c.1	1	1a28_STR_A_1 PDB CREDO	0.705	0.077	0.519	0.008
Rv3806c.1	1	1ere_EST_A_600 PDB CREDO	0.645	0.130	0.519	0.008
Rv3806c.1	4	1skx_RFP_A_1 PDB CREDO	0.607	0.171	0.519	0.008
Rv3806c.1	1	1ere_EST_E_600 PDB CREDO	0.644	0.131	0.518	0.008
Rv3806c.1	1	1lwe_NVP_A_999 PDB CREDO	0.615	0.161	0.518	0.008
Rv3806c.1	1	1pcg_EST_B_2 PDB CREDO	0.644	0.131	0.518	0.008
Rv3806c.1	1	1qku_EST_B_600 PDB CREDO	0.644	0.131	0.518	0.008
Rv3806c.1	1	1qku_EST_C_600 PDB CREDO	0.644	0.131	0.518	0.008
Rv3806c.1	4	2aqu_DR7_B_300 PDB CREDO	0.517	0.292	0.517	0.008
Rv3806c.1	3	3cyx_ROC_A_201 PDB CREDO	0.566	0.223	0.517	0.008
Rv3806c.1	1	1ere_EST_B_600 PDB CREDO	0.643	0.132	0.517	0.008
Rv3806c.1	3	1t7i_017_A_200 PDB CREDO	0.606	0.172	0.517	0.008
Rv3806c.1	4	3bjw_SVR_E_503 PDB CREDO	0.587	0.194	0.516	0.009
Rv3806c.1	4	3bjw_SVR_F_502 PDB CREDO	0.543	0.254	0.516	0.009
Rv3806c.1	3	3d1x_ROC_A_201 PDB CREDO	0.527	0.277	0.516	0.009
Rv3806c.1	1	4cox_IMN_A_701 PDB CREDO	0.561	0.229	0.515	0.009
Rv3806c.1	1	4cox_IMN_B_701 PDB CREDO	0.561	0.229	0.515	0.009
Rv3806c.1	4	1t46_STI_A_3 PDB CREDO	0.571	0.215	0.515	0.009
Rv3806c.1	4	1sdt_MK1_B_902 PDB CREDO	0.555	0.237	0.515	0.009
Rv3806c.1	4	3bjw_SVR_H_504 PDB CREDO	0.541	0.256	0.515	0.009
Rv3806c.1	1	3ls4_TCI_H_220 PDB CREDO	0.558	0.233	0.515	0.009
Rv3806c.1	1	1gwr_EST_B_600 PDB CREDO	0.640	0.135	0.514	0.009
Rv3806c.1	1	4cox_IMN_C_701 PDB CREDO	0.560	0.231	0.514	0.009
Rv3806c.1	4	2avv_MK1_A_901 PDB CREDO	0.581	0.203	0.514	0.009
Rv3806c.1	1	1cqp_803_A_311 PDB CREDO	0.638	0.136	0.514	0.009
Rv3806c.1	4	3ndt_ROC_D_100 PDB CREDO	0.566	0.222	0.513	0.009
Rv3806c.1	1	1pxx_DIF_A_701 PDB CREDO	0.558	0.233	0.513	0.009
Rv3806c.1	1	1udt_VIA_A_1000 PDB CREDO	0.608	0.169	0.512	0.009
Rv3806c.1	1	1vrt_NVP_A_999 PDB CREDO	0.608	0.169	0.512	0.009
Rv3806c.1	1	1ya3_STR_C_3001 PDB CREDO	0.646	0.128	0.512	0.009
Rv3806c.1	1	1pxx_DIF_B_1701 PDB CREDO	0.556	0.236	0.511	0.009
Rv3806c.1	1	1pxx_DIF_C_2701 PDB CREDO	0.556	0.236	0.511	0.009
Rv3806c.1	1	1s1x_NVP_A_999 PDB CREDO	0.607	0.171	0.511	0.009
Rv3806c.1	3	2pym_1UN_A_1001 PDB CREDO	0.660	0.115	0.511	0.009
Rv3806c.1	4	2nnk_ROC_A_401 PDB CREDO	0.563	0.226	0.511	0.009
Rv3806c.1	1	1fds_EST_A_350 PDB CREDO	0.555	0.237	0.510	0.009
Rv3806c.1	1	1pxx_DIF_D_3701 PDB CREDO	0.555	0.237	0.510	0.009
Rv3806c.1	4	3oxx_DR7_C_100 PDB CREDO	0.536	0.264	0.510	0.009
Rv3806c.1	1	1jlf_NVP_A_999 PDB CREDO	0.605	0.173	0.509	0.009
Rv3806c.1	1	3ads_IMN_B_3 PDB CREDO	0.554	0.238	0.509	0.009
Rv3806c.1	1	3pgh_FLP_A_701 PDB CREDO	0.633	0.142	0.509	0.009
Rv3806c.1	1	3kw2_ADN_B_300 PDB CREDO	0.552	0.241	0.509	0.009
Rv3806c.1	3	1xkk_FMM_A_91 PDB CREDO	0.709	0.074	0.509	0.010
Rv3806c.1	3	3tl9_ROC_A_401 PDB CREDO	0.520	0.288	0.509	0.010
Rv3806c.1	3	2pyn_1UN_A_1001 PDB CREDO	0.657	0.118	0.508	0.010
Rv3806c.1	4	1y0x_T44_X_500 PDB CREDO	0.749	0.049	0.508	0.010
Rv3806c.1	1	1ya3_STR_A_1001 PDB CREDO	0.714	0.070	0.508	0.010
Rv3806c.1	3	2q64_1UN_B_1001 PDB CREDO	0.656	0.118	0.508	0.010
Rv3806c.1	3	2qak_1UN_A_1001 PDB CREDO	0.656	0.118	0.508	0.010
Rv3806c.1	4	2r5p_MK1_D_902 PDB CREDO	0.534	0.266	0.508	0.010
Rv3806c.1	1	1qkn_RAL_A_600 PDB CREDO	0.815	0.019	0.507	0.010
Rv3806c.1	4	2r5p_MK1_B_902 PDB CREDO	0.533	0.268	0.507	0.010
Rv3806c.1	3	2q63_1UN_A_1001 PDB CREDO	0.654	0.121	0.506	0.010
Rv3806c.1	1	2jj8_AZZ_A_1211 PDB CREDO	0.659	0.116	0.506	0.010
Rv3806c.1	4	3k4v_ROC_D_201 PDB CREDO	0.585	0.198	0.506	0.010
Rv3806c.1	4	2avo_MK1_B_902 PDB CREDO	0.518	0.290	0.506	0.010
Rv3806c.1	4	1hsh_MK1_A_401 PDB CREDO	0.575	0.210	0.505	0.010
Rv3806c.1	4	1hxw_RIT_B_301 PDB CREDO	0.532	0.270	0.505	0.010
Rv3806c.1	1	1uho_VDN_A_1000 PDB CREDO	0.527	0.278	0.505	0.010
Rv3806c.1	1	3ln1_CEL_D_682 PDB CREDO	0.735	0.057	0.505	0.010
Rv3806c.1	1	2cbr_A80_A_201 PDB CREDO	0.614	0.163	0.505	0.010
Rv3806c.1	1	2prg_BRL_B_2 PDB CREDO	0.685	0.093	0.504	0.010
Rv3806c.1	1	1z9h_IMN_B_381 PDB CREDO	0.549	0.246	0.504	0.010
Rv3806c.1	4	2fxe_DR7_A_102 PDB CREDO	0.530	0.272	0.504	0.010
Rv3806c.1	4	3eky_DR7_A_100 PDB CREDO	0.530	0.272	0.504	0.010
Rv3806c.1	1	1ot7_IU5_B_1002 PDB CREDO	0.568	0.219	0.504	0.010
Rv3806c.1	1	1z9h_IMN_C_379 PDB CREDO	0.548	0.247	0.503	0.010
Rv3806c.1	1	1z9h_IMN_D_476 PDB CREDO	0.548	0.247	0.503	0.010
Rv3806c.1	4	1hxb_ROC_A_100 PDB CREDO	0.516	0.293	0.503	0.010
Rv3806c.1	4	3em4_DR7_V_100 PDB CREDO	0.529	0.274	0.503	0.010
Rv3806c.1	3	2nmy_ROC_A_401 PDB CREDO	0.537	0.262	0.503	0.010
Rv3806c.1	1	1z9h_IMN_A_379 PDB CREDO	0.547	0.249	0.503	0.010
Rv3806c.1	1	1fm6_BRL_D_503 PDB CREDO	0.682	0.095	0.503	0.011
Rv3806c.1	4	3d1y_ROC_A_201 PDB CREDO	0.528	0.276	0.502	0.011
Rv3806c.1	1	2h42_VIA_A_901 PDB CREDO	0.729	0.060	0.501	0.011
Rv3806c.1	4	3bvb_017_B_401 PDB CREDO	0.539	0.259	0.501	0.011
Rv3806c.1	4	1opj_STI_B_4 PDB CREDO	0.602	0.177	0.501	0.011
Rv3806c.1	1	3k54_1N1_A_1 PDB CREDO	0.632	0.143	0.500	0.011

Similarity to known drug target from sensitive sequence analysis

No drug targets

List of small molecules tested from TIBLE

Data not available

Off-target activity - ligand based from TIBLE

Data not available

Small molecules involved in protein-protein complex from TIMBAL .Proteins similar to Mtb based on sequence analysis.

Data not available

STITCH interactions

No high confidence interactions