SInCRe - Rv2868c

Tuberculist information

Gene name	gcpE
Protein function	Probable GcpE protein
Functional category(tuberculist)	conserved hypotheticals
Gene location(kb)	3179.37
Molecular mass(da)	40450.3
External sites	TB Database TubercuList WebTB

Protein sequence

Number of amino acids : 387

	  		  	1    VTVGLGMPQPPAPTLAPRRATRQLMVGNVGVGSDHPVSVQSMCTTKTHDVNSTLQQIAEL   60
			  	61   TAAGCDIVRVACPRQEDADALAEIARHSQIPVVADIHFQPRYIFAAIDAGCAAVRVNPGN  120
			  	121  IKEFDGRVGEVAKAAGAAGIPIRIGVNAGSLDKRFMEKYGKATPEALVESALWEASLFEE  180
			  	181  HGFGDIKISVKHNDPVVMVAAYELLAARCDYPLHLGVTEAGPAFQGTIKSAVAFGALLSR  240
			  	241  GIGDTIRVSLSAPPVEEVKVGNQVLESLNLRPRSLEIVSCPSCGRAQVDVYTLANEVTAG  300
			  	301  LDGLDVPLRVAVMGCVVNGPGEAREADLGVASGNGKGQIFVRGEVIKTVPEAQIVETLIE  360
			  	361  EAMRLAAEMGEQDPGATPSGSPIVTVS

Known structures in the PDB

No Known structures

Number of amino acids : 387

Domains assigned based on sequence.

Mtb Structural proteome models

CHOPIN models

Profile-based domain assignment

Structural/Functional domain family	Pfam acc.no./SCOP ID	Domain Region
GcpE	PF04551	21-366

Mtb Structural Proteome models

Model Number	1
Model name	Rv2868c.2
Template	1EYE APDB CREDO
Template coverage	5_273
Template Identity(%)	16.8
Model coverage(%)	59.5
Normalized DOPE score	-0.155

Model Number	2
Model name	Rv2868c.1
Template	1AD1 APDB CREDO
Template coverage	2_265
Template Identity(%)	15.4
Model coverage(%)	63.4
Normalized DOPE score	0.017

Model Number	3
Model name	Rv2868c
Template	1ZJ8 APDB CREDO
Template coverage	239_541
Template Identity(%)	17.2
Model coverage(%)	74.7
Normalized DOPE score	1.4

Structure Models from Chopin

Model Number	1
Profile	c.1.24.1 - 3.20.20.70 Click for model details
zscore	4.18
Residue begin	25
Residue end	244

Binding pockets

STRING

Cytoscape Web will replace the contents of this div with protein-protein interaction network.

Protein interacting with Rv2868c	Gene name	Confidence Score
Rv1110	lytB2	0.999
Rv2870c	dxr	0.999
Rv3581c	ispF	0.999
Rv2870c	dxr	0.999
Rv2870c	dxr	0.999
Rv3382c	lytB1	0.997
Rv2682c	dxs1	0.99
Rv2682c	dxs1	0.99
Rv2682c	dxs1	0.99
Rv3582c	ispD	0.98
Rv1011	ispE	0.969
Rv1011	ispE	0.969
Rv2869c	rip	0.969
Rv2580c	hisS	0.969
Rv2580c	hisS	0.969
Rv3379c	dxs2	0.949
Rv3379c	dxs2	0.949
Rv3379c	dxs2	0.949

Potential ligand/drug binding sites

Protein Model	Pocket Number	Drug Binding Site	PMIN Score	Pvalue PMIN	PMAX Score	Pvalue PMAX
Rv2868c.1	13	3el4_ROC_A_100 PDB CREDO	0.664	0.112	0.648	0.001
Rv2868c.1	13	1xkk_FMM_A_91 PDB CREDO	0.751	0.047	0.647	0.001
Rv2868c.1	13	1c6z_ROC_B_505 PDB CREDO	0.695	0.085	0.646	0.001
Rv2868c.2	1	1hwk_117_C_4 PDB CREDO	0.656	0.118	0.637	0.001
Rv2868c.2	1	1hwk_117_A_2 PDB CREDO	0.652	0.122	0.633	0.001
Rv2868c.2	1	1hwl_FBI_A_2 PDB CREDO	0.671	0.105	0.632	0.001
Rv2868c.2	1	1hwl_FBI_C_4 PDB CREDO	0.669	0.106	0.631	0.001
Rv2868c.1	13	2q64_1UN_B_1001 PDB CREDO	0.674	0.102	0.627	0.001
Rv2868c.1	13	3sm2_478_A_126 PDB CREDO	0.690	0.089	0.625	0.001
Rv2868c.1	13	1t7i_017_A_200 PDB CREDO	0.640	0.134	0.625	0.001
Rv2868c.1	13	2pym_1UN_A_1001 PDB CREDO	0.672	0.104	0.625	0.001
Rv2868c.1	13	2pyn_1UN_A_1001 PDB CREDO	0.671	0.104	0.624	0.001
Rv2868c.1	13	1k6c_MK1_B_902 PDB CREDO	0.637	0.138	0.622	0.001
Rv2868c.1	13	2q63_1UN_A_1001 PDB CREDO	0.668	0.108	0.620	0.001
Rv2868c.2	1	1hwl_FBI_B_1 PDB CREDO	0.658	0.117	0.620	0.001
Rv2868c.1	13	2qak_1UN_A_1001 PDB CREDO	0.667	0.109	0.620	0.001
Rv2868c.2	1	1hwl_FBI_D_3 PDB CREDO	0.657	0.118	0.619	0.001
Rv2868c.2	3	3k54_1N1_A_1 PDB CREDO	0.642	0.133	0.619	0.001
Rv2868c.2	1	1hwk_117_B_1 PDB CREDO	0.637	0.138	0.619	0.001
Rv2868c.1	13	1rl8_RIT_A_9001 PDB CREDO	0.648	0.126	0.618	0.002
Rv2868c.1	13	2nnk_ROC_A_401 PDB CREDO	0.617	0.159	0.617	0.002
Rv2868c.2	1	1hwk_117_D_3 PDB CREDO	0.674	0.102	0.616	0.002
Rv2868c.2	3	3jwq_VIA_B_901 PDB CREDO	0.614	0.162	0.614	0.002
Rv2868c.1	13	3ndt_ROC_D_100 PDB CREDO	0.612	0.164	0.612	0.002
Rv2868c.1	13	3gp0_NIL_A_1 PDB CREDO	0.728	0.061	0.611	0.002
Rv2868c.2	3	3bbt_FMM_D_91 PDB CREDO	0.677	0.099	0.610	0.002
Rv2868c.2	3	3h52_486_C_4 PDB CREDO	0.608	0.170	0.608	0.002
Rv2868c.2	3	2xkw_P1B_B_1475 PDB CREDO	0.606	0.171	0.606	0.002
Rv2868c.1	13	1t46_STI_A_3 PDB CREDO	0.741	0.053	0.606	0.002
Rv2868c.2	3	3bbt_FMM_B_91 PDB CREDO	0.673	0.103	0.603	0.002
Rv2868c.2	3	2h42_VIA_C_903 PDB CREDO	0.601	0.178	0.601	0.002
Rv2868c.2	3	3ri5_IVM_C_350 PDB CREDO	0.601	0.178	0.601	0.002
Rv2868c.2	3	3rif_IVM_A_402 PDB CREDO	0.601	0.178	0.601	0.002
Rv2868c.2	3	3rif_IVM_D_402 PDB CREDO	0.599	0.180	0.599	0.002
Rv2868c.2	3	3rif_IVM_B_403 PDB CREDO	0.599	0.181	0.599	0.002
Rv2868c.2	3	3oct_1N1_A_663 PDB CREDO	0.642	0.133	0.598	0.002
Rv2868c.2	3	1fm6_BRL_D_503 PDB CREDO	0.618	0.158	0.596	0.002
Rv2868c.2	3	1ya3_STR_B_2001 PDB CREDO	0.639	0.136	0.595	0.002
Rv2868c.1	13	1c6y_MK1_B_524 PDB CREDO	0.748	0.049	0.595	0.002
Rv2868c.2	3	1s9p_DES_A_459 PDB CREDO	0.617	0.159	0.595	0.002
Rv2868c.2	3	3ria_IVM_C_349 PDB CREDO	0.595	0.185	0.595	0.002
Rv2868c.2	3	1mx1_THA_C_3 PDB CREDO	0.614	0.162	0.593	0.002
Rv2868c.2	3	2prg_BRL_A_1 PDB CREDO	0.614	0.162	0.593	0.002
Rv2868c.2	3	3rif_IVM_A_403 PDB CREDO	0.592	0.189	0.592	0.002
Rv2868c.2	3	3oht_1N1_B_1000 PDB CREDO	0.609	0.168	0.588	0.003
Rv2868c.2	3	1ya3_STR_C_3001 PDB CREDO	0.609	0.168	0.588	0.003
Rv2868c.2	3	3jwq_VIA_D_901 PDB CREDO	0.653	0.122	0.587	0.003
Rv2868c.2	3	1jg3_ADN_A_500 PDB CREDO	0.609	0.169	0.587	0.003
Rv2868c.1	13	3k4v_ROC_D_201 PDB CREDO	0.614	0.162	0.586	0.003
Rv2868c.1	1	1hwk_117_B_1 PDB CREDO	0.620	0.156	0.586	0.003
Rv2868c.1	13	3pwr_ROC_A_401 PDB CREDO	0.600	0.179	0.585	0.003
Rv2868c.2	3	2h42_VIA_B_902 PDB CREDO	0.584	0.198	0.584	0.003
Rv2868c.2	3	1ya3_STR_A_1001 PDB CREDO	0.627	0.149	0.584	0.003
Rv2868c.2	3	3oht_1N1_A_1000 PDB CREDO	0.628	0.147	0.584	0.003
Rv2868c.2	3	2cbr_A80_A_201 PDB CREDO	0.628	0.148	0.583	0.003
Rv2868c.2	3	2prg_BRL_B_2 PDB CREDO	0.603	0.175	0.582	0.003
Rv2868c.2	3	3sxr_1N1_A_1 PDB CREDO	0.703	0.079	0.582	0.003
Rv2868c.1	13	3ufn_ROC_A_401 PDB CREDO	0.691	0.087	0.580	0.003
Rv2868c.2	1	1hwi_115_B_1 PDB CREDO	0.675	0.101	0.580	0.003
Rv2868c.1	3	4dta_ADN_A_401 PDB CREDO	0.606	0.172	0.580	0.003
Rv2868c.1	13	2nnp_ROC_A_401 PDB CREDO	0.594	0.187	0.580	0.003
Rv2868c.2	3	1gs4_ZK5_A_1918 PDB CREDO	0.579	0.206	0.579	0.003
Rv2868c.1	13	1n49_RIT_B_301 PDB CREDO	0.767	0.039	0.578	0.003
Rv2868c.1	13	3ucb_017_A_201 PDB CREDO	0.578	0.206	0.578	0.003
Rv2868c.2	1	1hwi_115_D_3 PDB CREDO	0.672	0.104	0.577	0.003
Rv2868c.2	3	1lhu_EST_A_301 PDB CREDO	0.598	0.181	0.577	0.003
Rv2868c.1	13	1hxb_ROC_A_100 PDB CREDO	0.621	0.155	0.577	0.003
Rv2868c.2	3	2gqg_1N1_A_501 PDB CREDO	0.577	0.208	0.577	0.003
Rv2868c.1	13	3ogq_AB1_A_200 PDB CREDO	0.652	0.122	0.577	0.003
Rv2868c.2	3	3aod_RFP_C_2002 PDB CREDO	0.597	0.183	0.575	0.003
Rv2868c.2	3	2q1v_PDN_A_248 PDB CREDO	0.618	0.159	0.575	0.003
Rv2868c.2	3	1p93_DEX_A_1999 PDB CREDO	0.639	0.136	0.575	0.003
Rv2868c.2	3	3rif_IVM_E_402 PDB CREDO	0.639	0.135	0.572	0.003
Rv2868c.2	3	1a28_STR_A_1 PDB CREDO	0.592	0.188	0.571	0.004
Rv2868c.2	3	1jg2_ADN_A_500 PDB CREDO	0.613	0.164	0.571	0.004
Rv2868c.2	3	2h42_VIA_A_901 PDB CREDO	0.634	0.140	0.571	0.004
Rv2868c.2	3	3ri5_IVM_B_349 PDB CREDO	0.638	0.137	0.571	0.004
Rv2868c.2	3	3rhw_IVM_B_349 PDB CREDO	0.637	0.137	0.570	0.004
Rv2868c.1	13	2f80_017_B_301 PDB CREDO	0.613	0.163	0.570	0.004
Rv2868c.2	3	3h0a_9RA_A_500 PDB CREDO	0.633	0.142	0.570	0.004
Rv2868c.1	1	1hwk_117_A_2 PDB CREDO	0.639	0.135	0.570	0.004
Rv2868c.2	3	1zgy_BRL_A_503 PDB CREDO	0.655	0.120	0.569	0.004
Rv2868c.2	3	3rhw_IVM_D_348 PDB CREDO	0.636	0.138	0.569	0.004
Rv2868c.2	3	3ri5_IVM_D_349 PDB CREDO	0.636	0.138	0.569	0.004
Rv2868c.2	3	3ria_IVM_A_348 PDB CREDO	0.636	0.138	0.569	0.004
Rv2868c.2	3	4eb6_VLB_C_503 PDB CREDO	0.569	0.217	0.569	0.004
Rv2868c.2	3	3rhw_IVM_D_349 PDB CREDO	0.636	0.139	0.569	0.004
Rv2868c.2	3	3adx_IMN_B_3 PDB CREDO	0.714	0.070	0.568	0.004
Rv2868c.2	3	3ria_IVM_E_348 PDB CREDO	0.635	0.140	0.568	0.004
Rv2868c.1	1	1hwk_117_C_4 PDB CREDO	0.637	0.138	0.568	0.004
Rv2868c.2	3	3ria_IVM_C_350 PDB CREDO	0.634	0.141	0.567	0.004
Rv2868c.2	3	3rhw_IVM_B_348 PDB CREDO	0.633	0.142	0.566	0.004
Rv2868c.2	3	1p93_DEX_B_2999 PDB CREDO	0.629	0.146	0.566	0.004
Rv2868c.1	13	3bvb_017_B_401 PDB CREDO	0.579	0.205	0.565	0.004
Rv2868c.2	3	3sxr_1N1_B_2 PDB CREDO	0.710	0.073	0.565	0.004
Rv2868c.1	13	3ndu_ROC_D_100 PDB CREDO	0.620	0.156	0.565	0.004
Rv2868c.2	3	3ri5_IVM_A_349 PDB CREDO	0.629	0.146	0.563	0.004
Rv2868c.2	3	3rhw_IVM_A_348 PDB CREDO	0.628	0.147	0.562	0.004
Rv2868c.1	13	3ekq_ROC_A_100 PDB CREDO	0.725	0.063	0.562	0.004
Rv2868c.2	3	3ln1_CEL_D_682 PDB CREDO	0.624	0.151	0.562	0.004
Rv2868c.2	3	2h77_T3_A_1 PDB CREDO	0.645	0.129	0.562	0.004
Rv2868c.2	3	1mx1_THA_E_5 PDB CREDO	0.582	0.201	0.561	0.004
Rv2868c.2	3	2fum_MIX_A_539 PDB CREDO	0.561	0.229	0.561	0.004
Rv2868c.2	3	3erd_DES_A_600 PDB CREDO	0.560	0.231	0.560	0.004
Rv2868c.2	3	3ria_IVM_E_349 PDB CREDO	0.626	0.150	0.560	0.004
Rv2868c.1	13	3el9_DR7_A_100 PDB CREDO	0.702	0.079	0.559	0.004
Rv2868c.2	3	3qt0_486_A_4 PDB CREDO	0.619	0.156	0.558	0.004
Rv2868c.1	1	1hwk_117_D_3 PDB CREDO	0.664	0.111	0.557	0.004
Rv2868c.1	1	1hwl_FBI_B_1 PDB CREDO	0.644	0.131	0.557	0.004
Rv2868c.2	3	2h79_T3_A_1 PDB CREDO	0.661	0.114	0.556	0.005
Rv2868c.1	13	3prs_RIT_A_1001 PDB CREDO	0.584	0.199	0.556	0.005
Rv2868c.1	1	1hwl_FBI_D_3 PDB CREDO	0.643	0.132	0.556	0.005
Rv2868c.2	3	1sqn_NDR_A_1001 PDB CREDO	0.576	0.209	0.556	0.005
Rv2868c.2	3	1nhz_486_A_800 PDB CREDO	0.638	0.137	0.555	0.005
Rv2868c.1	1	1hwl_FBI_A_2 PDB CREDO	0.641	0.133	0.555	0.005
Rv2868c.1	1	1hwl_FBI_C_4 PDB CREDO	0.640	0.134	0.554	0.005
Rv2868c.2	3	2aa6_STR_A_401 PDB CREDO	0.657	0.118	0.553	0.005
Rv2868c.2	3	1sqn_NDR_B_2001 PDB CREDO	0.573	0.213	0.553	0.005
Rv2868c.2	3	1bsx_T3_A_1 PDB CREDO	0.679	0.098	0.553	0.005
Rv2868c.2	3	1bsx_T3_B_2 PDB CREDO	0.679	0.098	0.553	0.005
Rv2868c.2	3	2aa6_STR_B_402 PDB CREDO	0.656	0.119	0.552	0.005
Rv2868c.2	3	2fum_MIX_D_3539 PDB CREDO	0.613	0.164	0.552	0.005
Rv2868c.2	3	2aax_PDN_B_503 PDB CREDO	0.655	0.119	0.551	0.005
Rv2868c.1	13	2nmy_ROC_A_401 PDB CREDO	0.619	0.157	0.551	0.005
Rv2868c.1	13	3el5_1UN_B_201 PDB CREDO	0.608	0.170	0.551	0.005
Rv2868c.2	3	2xpv_MIY_A_1209 PDB CREDO	0.571	0.216	0.551	0.005
Rv2868c.1	3	4dt8_ADN_A_401 PDB CREDO	0.575	0.211	0.550	0.005
Rv2868c.1	13	3tkg_ROC_C_901 PDB CREDO	0.589	0.192	0.549	0.005
Rv2868c.2	3	3kw2_ADN_A_300 PDB CREDO	0.590	0.191	0.548	0.005
Rv2868c.2	3	3gws_T3_X_500 PDB CREDO	0.673	0.103	0.548	0.005
Rv2868c.2	3	2aax_PDN_A_502 PDB CREDO	0.651	0.124	0.548	0.005
Rv2868c.2	3	3spk_TPV_A_100 PDB CREDO	0.629	0.146	0.547	0.005
Rv2868c.2	1	1hwi_115_A_2 PDB CREDO	0.702	0.080	0.547	0.005
Rv2868c.1	13	3ggu_017_B_201 PDB CREDO	0.635	0.140	0.547	0.005
Rv2868c.1	13	3cyx_ROC_A_201 PDB CREDO	0.600	0.179	0.546	0.005
Rv2868c.2	3	1jg3_ADN_B_550 PDB CREDO	0.634	0.140	0.546	0.005
Rv2868c.2	3	1lhv_NOG_A_301 PDB CREDO	0.691	0.088	0.545	0.005
Rv2868c.1	13	1hxw_RIT_B_301 PDB CREDO	0.630	0.145	0.543	0.006
Rv2868c.2	3	2uxo_TAC_B_1211 PDB CREDO	0.682	0.095	0.543	0.006
Rv2868c.2	3	1xzx_T3_X_500 PDB CREDO	0.688	0.090	0.543	0.006
Rv2868c.2	3	2aa5_STR_A_301 PDB CREDO	0.645	0.130	0.543	0.006
Rv2868c.1	13	2qxs_RAL_B_600 PDB CREDO	0.700	0.081	0.542	0.006
Rv2868c.2	3	1s9p_DES_D_600 PDB CREDO	0.562	0.228	0.542	0.006
Rv2868c.1	13	1n49_RIT_D_401 PDB CREDO	0.782	0.032	0.542	0.006
Rv2868c.1	13	3d1y_ROC_A_201 PDB CREDO	0.569	0.219	0.542	0.006
Rv2868c.1	13	2qxs_RAL_A_600 PDB CREDO	0.698	0.082	0.541	0.006
Rv2868c.2	3	2aa5_STR_B_302 PDB CREDO	0.643	0.132	0.541	0.006
Rv2868c.2	3	3qlg_1N1_A_601 PDB CREDO	0.627	0.149	0.540	0.006
Rv2868c.1	1	2nni_MTK_A_501 PDB CREDO	0.588	0.194	0.540	0.006
Rv2868c.1	13	3cs9_NIL_C_600 PDB CREDO	0.660	0.115	0.539	0.006
Rv2868c.2	3	3qlg_1N1_B_601 PDB CREDO	0.626	0.149	0.539	0.006
Rv2868c.2	3	3kw2_ADN_B_300 PDB CREDO	0.649	0.125	0.538	0.006
Rv2868c.1	13	3oxc_ROC_A_401 PDB CREDO	0.660	0.115	0.538	0.006
Rv2868c.2	3	1p93_DEX_C_3999 PDB CREDO	0.660	0.115	0.537	0.006
Rv2868c.2	3	3uvv_T3_A_501 PDB CREDO	0.681	0.096	0.537	0.006
Rv2868c.2	3	3o1c_ADN_A_127 PDB CREDO	0.557	0.234	0.537	0.006
Rv2868c.2	3	2ito_IRE_A_2020 PDB CREDO	0.599	0.180	0.536	0.006
Rv2868c.2	3	3erd_DES_B_800 PDB CREDO	0.536	0.263	0.536	0.006
Rv2868c.2	3	1a27_EST_A_350 PDB CREDO	0.622	0.153	0.536	0.006
Rv2868c.2	3	3g5d_1N1_A_1 PDB CREDO	0.622	0.153	0.536	0.006
Rv2868c.2	3	3ri5_IVM_E_349 PDB CREDO	0.647	0.127	0.536	0.006
Rv2868c.2	3	3mne_DEX_A_784 PDB CREDO	0.657	0.118	0.535	0.006
Rv2868c.2	3	1mx1_THA_D_4 PDB CREDO	0.646	0.128	0.535	0.006
Rv2868c.2	3	3g5d_1N1_B_1 PDB CREDO	0.621	0.154	0.535	0.006
Rv2868c.2	3	1uwh_BAX_A_1723 PDB CREDO	0.745	0.051	0.535	0.006
Rv2868c.2	3	1m2z_DEX_A_301 PDB CREDO	0.655	0.119	0.534	0.007
Rv2868c.1	13	3cs9_NIL_D_600 PDB CREDO	0.653	0.122	0.534	0.007
Rv2868c.2	3	1uwh_BAX_B_1723 PDB CREDO	0.743	0.052	0.533	0.007
Rv2868c.1	13	1hsh_MK1_A_401 PDB CREDO	0.670	0.106	0.533	0.007
Rv2868c.2	3	1m2z_DEX_D_401 PDB CREDO	0.654	0.121	0.533	0.007
Rv2868c.2	3	1p93_DEX_D_4999 PDB CREDO	0.654	0.121	0.533	0.007
Rv2868c.2	3	1oq5_CEL_A_701 PDB CREDO	0.532	0.270	0.532	0.007
Rv2868c.2	3	1mx1_THA_F_6 PDB CREDO	0.642	0.133	0.531	0.007
Rv2868c.1	13	3spk_TPV_B_100 PDB CREDO	0.789	0.029	0.531	0.007
Rv2868c.2	3	3gn8_DEX_B_247 PDB CREDO	0.651	0.123	0.530	0.007
Rv2868c.2	3	4eyb_0WO_A_303 PDB CREDO	0.549	0.245	0.530	0.007
Rv2868c.1	13	2aof_FRD_C_305 PDB CREDO	0.555	0.237	0.530	0.007
Rv2868c.2	3	1fm6_BRL_X_504 PDB CREDO	0.671	0.104	0.529	0.007
Rv2868c.1	13	2xkw_P1B_A_1478 PDB CREDO	0.598	0.181	0.529	0.007
Rv2868c.2	1	1hwi_115_C_4 PDB CREDO	0.750	0.048	0.529	0.007
Rv2868c.2	3	3gn8_DEX_A_247 PDB CREDO	0.645	0.129	0.526	0.007
Rv2868c.2	3	3k2h_LYA_B_514 PDB CREDO	0.544	0.252	0.525	0.007
Rv2868c.1	13	2fxd_DR7_A_102 PDB CREDO	0.659	0.115	0.525	0.007
Rv2868c.1	13	1hsh_MK1_C_402 PDB CREDO	0.658	0.116	0.524	0.008
Rv2868c.1	13	3s56_ROC_A_201 PDB CREDO	0.658	0.116	0.524	0.008
Rv2868c.2	3	3d90_NOG_B_2001 PDB CREDO	0.601	0.177	0.523	0.008
Rv2868c.2	3	2y6o_1N1_A_1892 PDB CREDO	0.662	0.113	0.522	0.008
Rv2868c.2	3	3d90_NOG_A_1001 PDB CREDO	0.600	0.179	0.522	0.008
Rv2868c.1	13	3el0_1UN_A_201 PDB CREDO	0.711	0.073	0.521	0.008
Rv2868c.1	13	3lzv_017_A_200 PDB CREDO	0.710	0.073	0.520	0.008
Rv2868c.2	3	2ity_IRE_A_2020 PDB CREDO	0.628	0.147	0.520	0.008
Rv2868c.2	3	3qgz_ADN_A_127 PDB CREDO	0.539	0.259	0.520	0.008
Rv2868c.2	3	3nrr_D16_B_520 PDB CREDO	0.558	0.233	0.520	0.008
Rv2868c.2	3	3ln1_CEL_B_682 PDB CREDO	0.637	0.138	0.519	0.008
Rv2868c.2	3	2w8y_NDR_B_1000 PDB CREDO	0.626	0.149	0.518	0.008
Rv2868c.2	3	3ln1_CEL_A_682 PDB CREDO	0.636	0.139	0.518	0.008
Rv2868c.2	3	3ln1_CEL_C_682 PDB CREDO	0.636	0.139	0.518	0.008
Rv2868c.2	3	3adx_IMN_A_2 PDB CREDO	0.517	0.292	0.517	0.008
Rv2868c.1	13	1sh9_RIT_B_301 PDB CREDO	0.649	0.126	0.516	0.009
Rv2868c.2	3	2hw2_RFP_A_1200 PDB CREDO	0.675	0.102	0.515	0.009
Rv2868c.2	3	3ads_IMN_A_2 PDB CREDO	0.552	0.241	0.514	0.009
Rv2868c.1	13	3ekx_1UN_B_201 PDB CREDO	0.582	0.202	0.514	0.009
Rv2868c.1	13	3so9_017_A_100 PDB CREDO	0.835	0.014	0.514	0.009
Rv2868c.2	3	1a28_STR_B_2 PDB CREDO	0.651	0.123	0.514	0.009
Rv2868c.2	3	1s9p_DES_B_459 PDB CREDO	0.620	0.156	0.513	0.009
Rv2868c.2	3	3frq_ERY_B_195 PDB CREDO	0.671	0.104	0.513	0.009
Rv2868c.1	13	1ohr_1UN_A_201 PDB CREDO	0.644	0.130	0.513	0.009
Rv2868c.1	1	1hwi_115_B_1 PDB CREDO	0.650	0.125	0.513	0.009
Rv2868c.2	3	2ab2_SNL_B_503 PDB CREDO	0.671	0.105	0.512	0.009
Rv2868c.2	3	1s9p_DES_C_500 PDB CREDO	0.619	0.157	0.512	0.009
Rv2868c.2	3	3ads_IMN_B_3 PDB CREDO	0.730	0.060	0.512	0.009
Rv2868c.2	3	4eyb_0WO_B_301 PDB CREDO	0.531	0.271	0.512	0.009
Rv2868c.1	13	1sdt_MK1_B_902 PDB CREDO	0.524	0.282	0.511	0.009
Rv2868c.2	3	3tkd_CYZ_A_266 PDB CREDO	0.669	0.107	0.511	0.009
Rv2868c.1	3	1v8b_ADN_B_1502 PDB CREDO	0.557	0.235	0.511	0.009
Rv2868c.2	3	2ab2_SNL_A_502 PDB CREDO	0.668	0.107	0.510	0.009
Rv2868c.2	3	1mx1_THA_A_1 PDB CREDO	0.697	0.083	0.510	0.009
Rv2868c.1	13	3tl9_ROC_A_401 PDB CREDO	0.600	0.180	0.510	0.009
Rv2868c.1	13	3pww_ROC_A_1001 PDB CREDO	0.623	0.153	0.509	0.009
Rv2868c.2	3	1cil_ETS_A_263 PDB CREDO	0.566	0.223	0.509	0.009
Rv2868c.1	1	1hwi_115_D_3 PDB CREDO	0.645	0.130	0.509	0.010
Rv2868c.1	3	1xwf_ADN_D_433 PDB CREDO	0.531	0.271	0.508	0.010
Rv2868c.2	3	1ie4_T44_B_328 PDB CREDO	0.589	0.192	0.507	0.010
Rv2868c.2	3	1m17_AQ4_A_999 PDB CREDO	0.664	0.111	0.507	0.010
Rv2868c.2	3	3tkd_CYZ_B_267 PDB CREDO	0.705	0.077	0.506	0.010
Rv2868c.1	3	1xwf_ADN_A_433 PDB CREDO	0.529	0.274	0.506	0.010
Rv2868c.1	3	1xwf_ADN_C_433 PDB CREDO	0.529	0.274	0.506	0.010
Rv2868c.2	3	3ut5_LOC_D_502 PDB CREDO	0.662	0.113	0.505	0.010
Rv2868c.1	13	3tkg_ROC_B_801 PDB CREDO	0.647	0.127	0.505	0.010
Rv2868c.2	3	2zva_1N1_A_513 PDB CREDO	0.610	0.167	0.505	0.010
Rv2868c.2	3	1z9y_FUN_A_500 PDB CREDO	0.564	0.225	0.505	0.010
Rv2868c.2	3	3f4x_KLT_A_300 PDB CREDO	0.564	0.225	0.505	0.010
Rv2868c.1	3	1d4f_ADN_A_601 PDB CREDO	0.621	0.154	0.504	0.010
Rv2868c.1	13	2r5p_MK1_D_902 PDB CREDO	0.585	0.197	0.504	0.010
Rv2868c.2	3	2itz_IRE_A_2021 PDB CREDO	0.633	0.141	0.504	0.010
Rv2868c.1	3	1v8b_ADN_D_3502 PDB CREDO	0.549	0.246	0.504	0.010
Rv2868c.1	3	1jdv_ADN_D_3260 PDB CREDO	0.526	0.278	0.503	0.010
Rv2868c.2	3	2oax_SNL_C_3001 PDB CREDO	0.658	0.116	0.503	0.010
Rv2868c.1	13	3oxx_DR7_C_100 PDB CREDO	0.528	0.276	0.503	0.010
Rv2868c.1	13	2avv_MK1_A_901 PDB CREDO	0.514	0.297	0.502	0.011
Rv2868c.1	13	1opj_STI_B_4 PDB CREDO	0.666	0.110	0.502	0.011
Rv2868c.1	13	2r5p_MK1_B_902 PDB CREDO	0.582	0.201	0.502	0.011
Rv2868c.1	3	1xwf_ADN_B_433 PDB CREDO	0.524	0.281	0.501	0.011
Rv2868c.2	3	1jin_KTN_A_801 PDB CREDO	0.605	0.172	0.501	0.011
Rv2868c.1	13	2aqu_DR7_B_300 PDB CREDO	0.552	0.241	0.501	0.011
Rv2868c.2	3	2oax_SNL_B_2001 PDB CREDO	0.655	0.119	0.500	0.011
Rv2868c.1	3	1jdv_ADN_A_1260 PDB CREDO	0.523	0.283	0.500	0.011

Similarity to known drug target from sensitive sequence analysis

No drug targets

List of small molecules tested from TIBLE

Data not available

Off-target activity - ligand based from TIBLE

Data not available

Small molecules involved in protein-protein complex from TIMBAL .Proteins similar to Mtb based on sequence analysis.

Data not available

STITCH interactions

Chemical Name	Confidence score	Molecular Weight
(E)-4-hydroxy-3-methyl-but-2-enyl pyrophosphatePubChem	0.975	262.091
2-C-methyl-D-erythritol-2,4-cyclopyrophosphatePubChem	0.968	278.091
2-C-methyl-D-erythritol 2,4-cyclodiphosphatePubChem	0.968	278.091
mevalonatePubChem	0.742	148.157
1-deoxy-D-xylulose 5-phosphatePubChem	0.736	214.11