SInCRe - Rv1391

Tuberculist information

Gene name	dfp
Protein function	Probable DNA/pantothenate metabolism flavoprotein homolog Dfp
Functional category(tuberculist)	intermediary metabolism and respiration
Gene location(kb)	1565.44
Molecular mass(da)	43544.9
External sites	TB Database TubercuList WebTB

Protein sequence

Number of amino acids : 418

	  		  	1    VVDHKRIPKQVIVGVSGGIAAYKACTVVRQLTEASHRVRVIPTESALRFVGAATFEALSG   60
			  	61   EPVCTDVFADVPAVPHVHLGQQADLVVVAPATADLLARAAAGRADDLLTATLLTARCPVL  120
			  	121  FAPAMHTEMWLHPATVDNVATLRRRGAVVLEPATGRLTGADSGAGRLPEAEEITTLAQLL  180
			  	181  LERHDALPYDLAGRKLLVTAGGTREPIDPVRFIGNRSSGKQGYAVARVAAQRGADVTLIA  240
			  	241  GHTAGLVDPAGVEVVHVSSAQQLADAVSKHAPTADVLVMAAAVADFRPAQVATAKIKKGV  300
			  	301  EGPPTIELLRNDDVLAGVVRARAHGQLPNMRAIVGFAAETGDANGDVLFHARAKLRRKGC  360
			  	361  DLLVVNAVGEGRAFEVDSNDGWLLASDGTESALQHGSKTLMASRIVDAIVTFLAGCSS

Known structures in the PDB

No Known structures

Number of amino acids : 418

Domains assigned based on sequence.

Mtb Structural proteome models

CHOPIN models

Profile-based domain assignment

Structural/Functional domain family	Pfam acc.no./SCOP ID	Domain Region
Flavoprotein	PF02441	9-135
DFP	PF04127	191-384

Mtb Structural Proteome models

Model Number	1
Model name	Rv1391.1
Template	1G63 APDB CREDO
Template coverage	4_144
Template Identity(%)	19.9
Model coverage(%)	34.2
Normalized DOPE score	-0.631

Model Number	2
Model name	Rv1391
Template	1U7Z APDB CREDO
Template coverage	184_402
Template Identity(%)	41.0
Model coverage(%)	54.1
Normalized DOPE score	-0.284

Structure Models from Chopin

Model Number	1
Profile	c.72.3.1 - 3.40.50.10300 Click for model details
zscore	31.11
Residue begin	191
Residue end	384

Model Number	2
Profile	c.34.1.1 - 3.40.50.1950 Click for model details
zscore	25.28
Residue begin	3
Residue end	194

Model Number	3
Profile	c.72.3.1 - 3.40.50.10300 Click for model details
zscore	23.37
Residue begin	19
Residue end	418

Binding pockets

STRING

Cytoscape Web will replace the contents of this div with protein-protein interaction network.

Protein interacting with Rv1391	Gene name	Confidence Score
Rv3600c	Rv3600c	0.998
Rv2965c	kdtB	0.996
Rv1092c	coaA	0.99
Rv2697c	dut	0.988
Rv1389	gmk	0.985
Rv3601c	panD	0.978
Rv3602c	panC	0.974
Rv2225	panB	0.963
Rv2786c	ribF	0.961
Rv2786c	ribF	0.961
Rv2334	cysK1	0.953
Rv1392	metK	0.949
Rv1392	metK	0.949
Rv1392	metK	0.949
Rv1390	rpoZ	0.915
Rv1409	ribG	0.902
Rv1409	ribG	0.902

Potential ligand/drug binding sites

Protein Model	Pocket Number	Drug Binding Site	PMIN Score	Pvalue PMIN	PMAX Score	Pvalue PMAX
Rv1391.1	7	1pcg_EST_B_2 PDB CREDO	0.733	0.058	0.635	0.001
Rv1391.1	7	3rem_SAL_B_301 PDB CREDO	0.667	0.109	0.634	0.001
Rv1391.1	7	1ere_EST_E_600 PDB CREDO	0.722	0.065	0.626	0.001
Rv1391.1	7	1ere_EST_B_600 PDB CREDO	0.721	0.066	0.625	0.001
Rv1391.1	7	1ere_EST_A_600 PDB CREDO	0.718	0.068	0.623	0.001
Rv1391.1	7	1qku_EST_B_600 PDB CREDO	0.718	0.068	0.623	0.001
Rv1391.1	7	1qku_EST_A_600 PDB CREDO	0.717	0.068	0.622	0.001
Rv1391.1	7	1g50_EST_B_1600 PDB CREDO	0.716	0.069	0.621	0.001
Rv1391.1	7	1qku_EST_C_600 PDB CREDO	0.715	0.070	0.619	0.001
Rv1391.1	7	1gwr_EST_B_600 PDB CREDO	0.707	0.075	0.613	0.002
Rv1391.1	7	3rem_SAL_A_301 PDB CREDO	0.635	0.140	0.604	0.002
Rv1391.1	7	1gwr_EST_A_600 PDB CREDO	0.695	0.085	0.603	0.002
Rv1391.1	7	2ocf_EST_A_596 PDB CREDO	0.778	0.034	0.590	0.003
Rv1391.1	7	1pcg_EST_A_1 PDB CREDO	0.777	0.034	0.589	0.003
Rv1391.1	7	1ere_EST_F_600 PDB CREDO	0.776	0.035	0.588	0.003
Rv1391.1	7	1ere_EST_D_600 PDB CREDO	0.774	0.035	0.587	0.003
Rv1391.1	7	1g50_EST_C_2600 PDB CREDO	0.774	0.035	0.587	0.003
Rv1391.1	7	1ere_EST_C_600 PDB CREDO	0.773	0.036	0.586	0.003
Rv1391.1	7	3hm1_J3Z_B_1 PDB CREDO	0.773	0.036	0.586	0.003
Rv1391.1	7	2j7x_EST_A_1454 PDB CREDO	0.772	0.036	0.586	0.003
Rv1391.1	7	3hgx_SAL_B_104 PDB CREDO	0.713	0.071	0.579	0.003
Rv1391.1	7	1a52_EST_A_1 PDB CREDO	0.761	0.042	0.577	0.003
Rv1391.1	7	1a52_EST_B_2 PDB CREDO	0.760	0.043	0.576	0.003
Rv1391.1	7	3ret_SAL_B_201 PDB CREDO	0.709	0.074	0.576	0.003
Rv1391.1	7	1qkt_EST_A_600 PDB CREDO	0.759	0.043	0.575	0.003
Rv1391.1	7	3oll_EST_A_600 PDB CREDO	0.746	0.050	0.566	0.004
Rv1391.1	7	3oll_EST_B_600 PDB CREDO	0.746	0.050	0.566	0.004
Rv1391.1	7	3hgx_SAL_A_102 PDB CREDO	0.692	0.087	0.562	0.004
Rv1391.1	7	1gse_EAA_B_224 PDB CREDO	0.581	0.203	0.552	0.005
Rv1391.1	7	1gse_EAA_A_224 PDB CREDO	0.579	0.204	0.551	0.005
Rv1391.1	7	3ret_SAL_A_201 PDB CREDO	0.674	0.102	0.548	0.005
Rv1391.1	7	2bxe_1FL_A_2003 PDB CREDO	0.571	0.216	0.543	0.006
Rv1391.1	7	2bxe_1FL_B_2003 PDB CREDO	0.567	0.221	0.539	0.006
Rv1391.1	7	3ug2_IRE_A_1 PDB CREDO	0.527	0.277	0.527	0.007
Rv1391.1	7	1g50_EST_A_600 PDB CREDO	0.785	0.030	0.526	0.007
Rv1391.1	7	3ols_EST_B_600 PDB CREDO	0.780	0.033	0.522	0.008
Rv1391.1	7	1cqp_803_A_311 PDB CREDO	0.600	0.179	0.520	0.008
Rv1391.1	7	3ols_EST_A_600 PDB CREDO	0.777	0.034	0.520	0.008
Rv1391.1	7	3hm1_J3Z_A_2 PDB CREDO	0.599	0.180	0.519	0.008
Rv1391.1	7	2yja_EST_B_1550 PDB CREDO	0.772	0.036	0.517	0.008
Rv1391.1	7	3uud_EST_A_600 PDB CREDO	0.768	0.038	0.514	0.009
Rv1391.1	7	3rf4_FUN_B_202 PDB CREDO	0.540	0.259	0.513	0.009
Rv1391.1	7	3lfa_1N1_A_361 PDB CREDO	0.706	0.076	0.513	0.009
Rv1391.1	7	3rf4_FUN_A_201 PDB CREDO	0.537	0.262	0.511	0.009
Rv1391.1	7	3uud_EST_B_600 PDB CREDO	0.761	0.042	0.509	0.009
Rv1391.1	7	3rf4_FUN_C_203 PDB CREDO	0.533	0.268	0.507	0.010
Rv1391.1	7	3vkx_T3_A_301 PDB CREDO	0.526	0.279	0.501	0.011
Rv1391.1	7	1s9p_DES_C_500 PDB CREDO	0.778	0.034	0.500	0.011

Similarity to known drug target from sensitive sequence analysis

No drug targets

List of small molecules tested from TIBLE

Data not available

Off-target activity - ligand based from TIBLE

Data not available

Small molecules involved in protein-protein complex from TIMBAL .Proteins similar to Mtb based on sequence analysis.

Data not available

STITCH interactions

Chemical Name	Confidence score	Molecular Weight
4'-phosphopantothenatePubChem	0.983	299.215
4'-phosphopantetheinePubChem	0.947	358.348
half-cystinePubChem	0.926	121.158
flavin mononucleotidePubChem	0.911	456.344
4'-phosphopantothenoylcysteinePubChem	0.904	402.358
carbon dioxidePubChem	0.9	44.0095
4'-phosphopantetheine groupPubChem	0.9	358.348
coenzyme APubChem	0.804	767.534
pantothenolPubChem	0.778	205.251
phosphatePubChem	0.744	96.9872
panthenolPubChem	0.733	205.251
pantothenic acidPubChem	0.713	219.235