SInCRe - Rv0086

Tuberculist information

Gene name	hycQ
Protein function	Possible hydrogenase HycQ
Functional category(tuberculist)	intermediary metabolism and respiration
Gene location(kb)	93.951
Molecular mass(da)	49226.7
External sites	TB Database TubercuList WebTB

Protein sequence

Number of amino acids : 488

	  		  	1    MTGLLLAAILAPLAASIASLITGWRRTTATLTALSATTVLACAVAMGFWMGSGAQFGLGG   60
			  	61   LLRADALTVVMLVVIGIVGTLATAASIGYIDTELAHGHIDGRSARLYGVLTPAFLCAMVL  120
			  	121  AVCANNIGVIWVAIEATTVITAFLVGHRRTRTALEATWKYVVICSVGIAVAFLGTVLLYF  180
			  	181  AARDSGAAAAGALNLDILAEHAAGLDPGVARLAGGLLLIGYGAKAGLFPFHTWLADAHSQ  240
			  	241  APAPVSALMSGVLLAVAFSVLIRLRPILDAVSGPAYLRNGLLVVGLATLLVAVLMLTVTG  300
			  	301  DVKRMLAYSSMEHMGLIAIAAAAGTTLAIAALLLHVLAHGIGKTVLFLAGGQLQAAHDST  360
			  	361  AIADITGVMRRSRLIGVSFAVGLIVLLGLPPFAMFASELAIARSLANERLAWVLGAALLL  420
			  	421  IAIGFTALARNSGRMLLGTPAAGAPAITVPATAAAALMVGIVVSAALGITAGPLADLLGI  480
			  	481  AASNVGLP

Known structures in the PDB

No Known structures

Number of amino acids : 488

Domains assigned based on sequence.

Mtb Structural proteome models

CHOPIN models

Profile-based domain assignment

Structural/Functional domain family	Pfam acc.no./SCOP ID	Domain Region
Oxidored_q1	PF00361	124-405

Mtb Structural Proteome models

Model Number	1
Model name	Rv0086.2
Template	1XME APDB CREDO
Template coverage	24_209
Template Identity(%)	20.4
Model coverage(%)	40.4
Normalized DOPE score	1.442

Model Number	2
Model name	Rv0086
Template	1V54 APDB CREDO
Template coverage	82_495
Template Identity(%)	12.1
Model coverage(%)	82.6
Normalized DOPE score	1.899

Structure Models from Chopin

CHOPIN models not available for this query

Binding pockets

STRING

Cytoscape Web will replace the contents of this div with protein-protein interaction network.

Protein interacting with Rv0086	Gene name	Confidence Score
Rv0087	hycE	0.999
Rv0085	hycP	0.999
Rv0087	hycE	0.999
Rv0087	hycE	0.999
Rv0084	hycD	0.995
Rv0082	Rv0082	0.992
Rv0083	Rv0083	0.975
Rv3148	nuoD	0.917
Rv3152	nuoH	0.904
Rv3153	nuoI	0.903

Potential ligand/drug binding sites

Protein Model	Pocket Number	Drug Binding Site	PMIN Score	Pvalue PMIN	PMAX Score	Pvalue PMAX
Rv0086.2	3	3vkx_T3_A_301 PDB CREDO	0.703	0.079	0.636	0.001
Rv0086.2	3	1xbb_STI_A_1 PDB CREDO	0.606	0.171	0.577	0.003
Rv0086.2	3	3ug2_IRE_A_1 PDB CREDO	0.597	0.182	0.568	0.004
Rv0086.2	2	3jw3_TOP_B_208 PDB CREDO	0.677	0.099	0.561	0.004
Rv0086.2	2	3jw3_TOP_A_208 PDB CREDO	0.753	0.046	0.556	0.005
Rv0086.2	3	2nnj_225_A_501 PDB CREDO	0.581	0.203	0.552	0.005
Rv0086.2	3	3r9c_ECL_A_451 PDB CREDO	0.580	0.203	0.551	0.005
Rv0086.2	3	1ya4_CTX_B_2 PDB CREDO	0.896	0.003	0.548	0.005
Rv0086.2	3	1ya4_CTX_C_3 PDB CREDO	0.896	0.003	0.548	0.005
Rv0086.2	3	3jw5_TOP_A_208 PDB CREDO	0.571	0.216	0.542	0.006
Rv0086.2	3	3fl9_TOP_A_200 PDB CREDO	0.568	0.219	0.540	0.006
Rv0086.2	3	3jw3_TOP_A_208 PDB CREDO	0.668	0.107	0.540	0.006
Rv0086.2	3	3jw5_TOP_B_208 PDB CREDO	0.568	0.219	0.540	0.006
Rv0086.2	3	3n8y_DIF_B_585 PDB CREDO	0.624	0.151	0.539	0.006
Rv0086.2	3	1tbf_VIA_A_501 PDB CREDO	0.653	0.122	0.538	0.006
Rv0086.2	3	3fl9_TOP_G_200 PDB CREDO	0.565	0.223	0.537	0.006
Rv0086.2	3	3fl9_TOP_B_200 PDB CREDO	0.564	0.225	0.536	0.006
Rv0086.2	2	3fl9_TOP_E_200 PDB CREDO	0.725	0.063	0.535	0.006
Rv0086.2	3	3jwq_VIA_C_901 PDB CREDO	0.535	0.266	0.535	0.006
Rv0086.2	2	3fl9_TOP_D_200 PDB CREDO	0.723	0.065	0.533	0.007
Rv0086.2	3	1gwr_EST_A_600 PDB CREDO	0.642	0.132	0.530	0.007
Rv0086.2	3	1mx1_THA_B_2 PDB CREDO	0.797	0.026	0.529	0.007
Rv0086.2	2	3fl9_TOP_F_200 PDB CREDO	0.716	0.069	0.529	0.007
Rv0086.2	3	1ere_EST_B_600 PDB CREDO	0.641	0.133	0.529	0.007
Rv0086.2	3	1gwr_EST_B_600 PDB CREDO	0.641	0.133	0.529	0.007
Rv0086.2	3	1ere_EST_A_600 PDB CREDO	0.640	0.135	0.527	0.007
Rv0086.2	3	1pcg_EST_B_2 PDB CREDO	0.640	0.135	0.527	0.007
Rv0086.2	3	1qku_EST_B_600 PDB CREDO	0.640	0.135	0.527	0.007
Rv0086.2	3	1xoz_CIA_A_501 PDB CREDO	0.638	0.136	0.526	0.007
Rv0086.2	3	1ere_EST_E_600 PDB CREDO	0.637	0.137	0.525	0.007
Rv0086.2	3	1qku_EST_C_600 PDB CREDO	0.637	0.137	0.525	0.007
Rv0086.2	3	1qku_EST_A_600 PDB CREDO	0.636	0.139	0.524	0.008
Rv0086.2	3	3hm1_J3Z_A_2 PDB CREDO	0.633	0.141	0.522	0.008
Rv0086.2	3	1g50_EST_B_1600 PDB CREDO	0.632	0.143	0.521	0.008
Rv0086.2	3	2w9s_TOP_C_1160 PDB CREDO	0.548	0.247	0.521	0.008
Rv0086.2	2	1muo_ADN_A_1 PDB CREDO	0.556	0.235	0.520	0.008
Rv0086.2	3	2w9s_TOP_A_1160 PDB CREDO	0.547	0.249	0.519	0.008
Rv0086.2	3	3b2r_VDN_A_1 PDB CREDO	0.658	0.117	0.518	0.008
Rv0086.2	3	3b2r_VDN_B_1 PDB CREDO	0.658	0.117	0.518	0.008
Rv0086.2	3	1r9o_FLP_A_501 PDB CREDO	0.624	0.151	0.515	0.009
Rv0086.2	3	2bdm_TMI_A_502 PDB CREDO	0.540	0.259	0.513	0.009
Rv0086.2	3	2ocf_EST_A_596 PDB CREDO	0.709	0.074	0.512	0.009
Rv0086.2	3	3hm1_J3Z_B_1 PDB CREDO	0.709	0.074	0.512	0.009
Rv0086.2	3	1ere_EST_D_600 PDB CREDO	0.708	0.075	0.511	0.009
Rv0086.2	3	3oll_EST_A_600 PDB CREDO	0.708	0.075	0.511	0.009
Rv0086.2	3	3lfa_1N1_A_361 PDB CREDO	0.737	0.055	0.510	0.009
Rv0086.2	3	1a52_EST_B_2 PDB CREDO	0.706	0.076	0.510	0.009
Rv0086.2	3	1ere_EST_C_600 PDB CREDO	0.706	0.076	0.510	0.009
Rv0086.2	3	1ere_EST_F_600 PDB CREDO	0.706	0.076	0.510	0.009
Rv0086.2	2	1lin_TFP_A_156 PDB CREDO	0.584	0.199	0.510	0.009
Rv0086.2	3	3fl9_TOP_C_200 PDB CREDO	0.565	0.224	0.509	0.009
Rv0086.2	3	2j7x_EST_A_1454 PDB CREDO	0.705	0.077	0.509	0.010
Rv0086.2	3	1g50_EST_A_600 PDB CREDO	0.799	0.025	0.509	0.010
Rv0086.2	3	3ols_EST_B_600 PDB CREDO	0.799	0.025	0.509	0.010
Rv0086.2	3	1mx1_THA_F_6 PDB CREDO	0.831	0.015	0.508	0.010
Rv0086.2	3	3clb_TMQ_B_612 PDB CREDO	0.615	0.161	0.507	0.010
Rv0086.2	3	1qkt_EST_A_600 PDB CREDO	0.703	0.079	0.507	0.010
Rv0086.2	3	3oll_EST_B_600 PDB CREDO	0.703	0.079	0.507	0.010
Rv0086.2	3	3ols_EST_A_600 PDB CREDO	0.794	0.027	0.505	0.010
Rv0086.2	3	1mx1_THA_D_4 PDB CREDO	0.826	0.016	0.505	0.010
Rv0086.2	3	1a52_EST_A_1 PDB CREDO	0.700	0.081	0.505	0.010
Rv0086.2	3	1g50_EST_C_2600 PDB CREDO	0.700	0.081	0.505	0.010
Rv0086.2	3	1pcg_EST_A_1 PDB CREDO	0.700	0.081	0.505	0.010
Rv0086.2	3	3ads_IMN_B_3 PDB CREDO	0.699	0.082	0.504	0.010
Rv0086.2	2	1q97_ADN_B_486 PDB CREDO	0.619	0.157	0.503	0.010
Rv0086.2	3	3hbb_TMQ_A_611 PDB CREDO	0.582	0.201	0.503	0.010
Rv0086.2	3	2yja_EST_B_1550 PDB CREDO	0.788	0.029	0.502	0.011
Rv0086.2	2	3hgx_SAL_B_104 PDB CREDO	0.718	0.068	0.502	0.011
Rv0086.2	2	3ret_SAL_B_201 PDB CREDO	0.718	0.068	0.502	0.011
Rv0086.2	3	3uud_EST_A_600 PDB CREDO	0.786	0.030	0.500	0.011

Similarity to known drug target from sensitive sequence analysis

No drug targets

List of small molecules tested from TIBLE

Data not available

Off-target activity - ligand based from TIBLE

Data not available

Small molecules involved in protein-protein complex from TIMBAL .Proteins similar to Mtb based on sequence analysis.

Data not available

STITCH interactions

No high confidence interactions