SInCRe - Rv3919c

Tuberculist information

Gene name	gid
Protein function	Probable glucose-inhibited division protein B Gid
Functional category(tuberculist)	cell wall and cell processes
Gene location(kb)	4407.53
Molecular mass(da)	24031.9
External sites	TB Database TubercuList WebTB

Protein sequence

Number of amino acids : 224

	  		  	1    MSPIEPAASAIFGPRLGLARRYAEALAGPGVERGLVGPREVGRLWDRHLLNCAVIGELLE   60
			  	61   RGDRVVDIGSGAGLPGVPLAIARPDLQVVLLEPLLRRTEFLREMVTDLGVAVEIVRGRAE  120
			  	121  ESWVQDQLGGSDAAVSRAVAALDKLTKWSMPLIRPNGRMLAIKGERAHDEVREHRRVMIA  180
			  	181  SGAVDVRVVTCGANYLRPPATVVFARRGKQIARGSARMASGGTA

Known structures in the PDB

No Known structures

Number of amino acids : 224

Domains assigned based on sequence.

Mtb Structural proteome models

CHOPIN models

Profile-based domain assignment

Structural/Functional domain family	Pfam acc.no./SCOP ID	Domain Region
GidB	PF02527	15-200

Mtb Structural Proteome models

Model Number	1
Model name	Rv3919c
Template	1JSX APDB CREDO
Template coverage	52_173
Template Identity(%)	37.7
Model coverage(%)	55.1
Normalized DOPE score	-0.715

Model Number	2
Model name	Rv3919c.1
Template	1XDZ APDB CREDO
Template coverage	10_228
Template Identity(%)	20.6
Model coverage(%)	96.4
Normalized DOPE score	-0.532

Structure Models from Chopin

Model Number	1
Profile	c.66.1.20 - 3.40.50.150 Click for model details
zscore	36.78
Residue begin	1
Residue end	224

Binding pockets

STRING

Cytoscape Web will replace the contents of this div with protein-protein interaction network.

Protein interacting with Rv3919c	Gene name	Confidence Score
Rv3917c	parB	0.987
Rv3917c	parB	0.987
Rv0001	dnaA	0.959
Rv0001	dnaA	0.959
Rv3918c	parA	0.958
Rv0682	rpsL	0.952
Rv3924c	rpmH	0.942
Rv3922c	Rv3922c	0.902

Potential ligand/drug binding sites

Protein Model	Pocket Number	Drug Binding Site	PMIN Score	Pvalue PMIN	PMAX Score	Pvalue PMAX
Rv3919c.1	5	3gcs_BAX_A_401 PDB CREDO	0.688	0.090	0.648	0.001
Rv3919c.1	5	3heg_BAX_A_1 PDB CREDO	0.650	0.125	0.630	0.001
Rv3919c.1	5	3hec_STI_A_1 PDB CREDO	0.639	0.135	0.601	0.002
Rv3919c.1	5	4asd_BAX_A_1500 PDB CREDO	0.615	0.161	0.579	0.003
Rv3919c.1	5	2oiq_STI_A_1001 PDB CREDO	0.589	0.192	0.572	0.003
Rv3919c.1	5	3ogp_017_A_200 PDB CREDO	0.589	0.192	0.572	0.003
Rv3919c.1	5	1n49_RIT_D_401 PDB CREDO	0.637	0.137	0.566	0.004
Rv3919c.1	5	1err_RAL_A_600 PDB CREDO	0.584	0.199	0.566	0.004
Rv3919c.1	5	1err_RAL_B_600 PDB CREDO	0.582	0.201	0.565	0.004
Rv3919c.1	5	3oez_STI_B_601 PDB CREDO	0.600	0.179	0.564	0.004
Rv3919c.1	5	2jfa_RAL_B_600 PDB CREDO	0.580	0.203	0.563	0.004
Rv3919c.1	5	3spk_TPV_B_100 PDB CREDO	0.615	0.162	0.562	0.004
Rv3919c.1	5	2pl0_STI_A_200 PDB CREDO	0.579	0.206	0.561	0.004
Rv3919c.1	5	2hw2_RFP_A_1200 PDB CREDO	0.583	0.200	0.548	0.005
Rv3919c.1	5	1d4y_TPV_A_501 PDB CREDO	0.548	0.247	0.548	0.005
Rv3919c.1	5	3gp0_NIL_A_1 PDB CREDO	0.747	0.050	0.548	0.005
Rv3919c.1	5	2o4n_TPV_A_300 PDB CREDO	0.547	0.248	0.547	0.005
Rv3919c.1	7	2w9g_TOP_A_1159 PDB CREDO	0.547	0.249	0.547	0.005
Rv3919c.1	5	2hyy_STI_B_600 PDB CREDO	0.562	0.228	0.545	0.005
Rv3919c.1	19	1uay_ADN_B_1002 PDB CREDO	0.573	0.213	0.541	0.006
Rv3919c.1	5	2jfa_RAL_A_600 PDB CREDO	0.575	0.210	0.540	0.006
Rv3919c.1	5	1t7j_478_A_200 PDB CREDO	0.540	0.258	0.540	0.006
Rv3919c.1	5	3ogp_017_B_200 PDB CREDO	0.602	0.176	0.535	0.006
Rv3919c.1	5	3oez_STI_A_601 PDB CREDO	0.601	0.177	0.534	0.006
Rv3919c.1	5	1xkk_FMM_A_91 PDB CREDO	0.744	0.051	0.531	0.007
Rv3919c.1	19	1fb7_ROC_A_100 PDB CREDO	0.529	0.275	0.529	0.007
Rv3919c.1	5	3so9_017_A_100 PDB CREDO	0.528	0.275	0.528	0.007
Rv3919c.1	5	2y6o_1N1_A_1892 PDB CREDO	0.579	0.205	0.527	0.007
Rv3919c.1	7	3qfx_CP6_B_702 PDB CREDO	0.527	0.277	0.527	0.007
Rv3919c.1	7	1fdw_EST_A_350 PDB CREDO	0.526	0.279	0.526	0.007
Rv3919c.1	7	3qfx_CP6_A_602 PDB CREDO	0.526	0.279	0.526	0.007
Rv3919c.1	5	3spk_TPV_A_100 PDB CREDO	0.637	0.138	0.525	0.007
Rv3919c.1	5	1n49_RIT_B_301 PDB CREDO	0.642	0.132	0.524	0.008
Rv3919c.1	6	1e7c_HLT_A_4008 PDB CREDO	0.579	0.205	0.524	0.008
Rv3919c.1	7	3fl9_TOP_C_200 PDB CREDO	0.553	0.240	0.523	0.008
Rv3919c.1	5	1sa1_POD_D_701 PDB CREDO	0.539	0.260	0.523	0.008
Rv3919c.1	5	2qxs_RAL_B_600 PDB CREDO	0.657	0.117	0.522	0.008
Rv3919c.1	5	1sa1_POD_B_700 PDB CREDO	0.554	0.238	0.522	0.008
Rv3919c.1	5	2qxs_RAL_A_600 PDB CREDO	0.657	0.118	0.522	0.008
Rv3919c.1	5	3cs9_NIL_A_600 PDB CREDO	0.638	0.137	0.521	0.008
Rv3919c.1	5	1uwh_BAX_B_1723 PDB CREDO	0.519	0.289	0.519	0.008
Rv3919c.1	5	1uwh_BAX_A_1723 PDB CREDO	0.518	0.290	0.518	0.008
Rv3919c.1	5	3lzv_017_A_200 PDB CREDO	0.618	0.158	0.518	0.008
Rv3919c.1	5	2r5q_1UN_D_900 PDB CREDO	0.567	0.221	0.518	0.008
Rv3919c.1	19	1sn0_T44_B_602 PDB CREDO	0.610	0.168	0.518	0.008
Rv3919c.1	5	2o4p_TPV_A_300 PDB CREDO	0.565	0.223	0.517	0.008
Rv3919c.1	5	2r5q_1UN_B_900 PDB CREDO	0.564	0.225	0.515	0.009
Rv3919c.1	5	1xzx_T3_X_500 PDB CREDO	0.566	0.222	0.515	0.009
Rv3919c.1	5	3el0_1UN_A_201 PDB CREDO	0.613	0.164	0.514	0.009
Rv3919c.1	7	1j3j_CP6_B_709 PDB CREDO	0.514	0.297	0.514	0.009
Rv3919c.1	7	3qgt_CP6_A_609 PDB CREDO	0.514	0.297	0.514	0.009
Rv3919c.1	7	3qgt_CP6_B_609 PDB CREDO	0.512	0.300	0.512	0.009
Rv3919c.1	5	1y0x_T44_X_500 PDB CREDO	0.512	0.300	0.512	0.009
Rv3919c.1	7	2bl9_CP6_A_1240 PDB CREDO	0.511	0.302	0.511	0.009
Rv3919c.1	7	2bla_CP6_A_1240 PDB CREDO	0.511	0.302	0.511	0.009
Rv3919c.1	5	3uvv_T3_A_501 PDB CREDO	0.561	0.229	0.510	0.009
Rv3919c.1	7	3mdt_VOR_A_506 PDB CREDO	0.538	0.262	0.509	0.009
Rv3919c.1	5	2xkw_P1B_B_1475 PDB CREDO	0.709	0.074	0.509	0.009
Rv3919c.1	7	1j3j_CP6_A_609 PDB CREDO	0.509	0.304	0.509	0.009
Rv3919c.1	7	3fl9_TOP_B_200 PDB CREDO	0.566	0.222	0.509	0.010
Rv3919c.1	7	3um5_CP6_B_709 PDB CREDO	0.536	0.264	0.508	0.010
Rv3919c.1	7	3um5_CP6_A_609 PDB CREDO	0.535	0.266	0.506	0.010
Rv3919c.1	7	3jw5_TOP_B_208 PDB CREDO	0.563	0.226	0.506	0.010
Rv3919c.1	19	2bxg_IBP_B_2002 PDB CREDO	0.534	0.266	0.505	0.010
Rv3919c.1	7	2w9s_TOP_B_1160 PDB CREDO	0.505	0.311	0.505	0.010
Rv3919c.1	19	1yi4_ADN_A_306 PDB CREDO	0.562	0.228	0.504	0.010
Rv3919c.1	7	3fl9_TOP_G_200 PDB CREDO	0.560	0.230	0.503	0.010
Rv3919c.1	5	3cs9_NIL_B_600 PDB CREDO	0.634	0.141	0.503	0.010
Rv3919c.1	5	1uwj_BAX_B_1723 PDB CREDO	0.534	0.266	0.503	0.010
Rv3919c.1	5	1uob_PNN_A_1311 PDB CREDO	0.518	0.290	0.503	0.010
Rv3919c.1	5	1t46_STI_A_3 PDB CREDO	0.668	0.108	0.502	0.011
Rv3919c.1	5	3mss_STI_B_1 PDB CREDO	0.566	0.223	0.502	0.011
Rv3919c.1	5	3mss_STI_D_1 PDB CREDO	0.566	0.223	0.502	0.011
Rv3919c.1	7	3mdt_VOR_B_506 PDB CREDO	0.530	0.273	0.502	0.011
Rv3919c.1	7	3mg0_BO2_K_1402 PDB CREDO	0.530	0.273	0.502	0.011
Rv3919c.1	5	3oht_1N1_B_1000 PDB CREDO	0.675	0.101	0.502	0.011
Rv3919c.1	5	1iep_STI_B_202 PDB CREDO	0.565	0.223	0.502	0.011
Rv3919c.1	7	3qg2_CP6_A_609 PDB CREDO	0.502	0.316	0.502	0.011
Rv3919c.1	5	2hyy_STI_D_600 PDB CREDO	0.565	0.224	0.501	0.011
Rv3919c.1	5	1bsx_T3_A_1 PDB CREDO	0.568	0.219	0.501	0.011
Rv3919c.1	5	1bsx_T3_B_2 PDB CREDO	0.568	0.219	0.501	0.011
Rv3919c.1	7	3jw5_TOP_A_208 PDB CREDO	0.557	0.234	0.501	0.011
Rv3919c.1	5	2hyy_STI_C_600 PDB CREDO	0.564	0.225	0.501	0.011
Rv3919c.1	5	3ms9_STI_B_1 PDB CREDO	0.564	0.225	0.501	0.011

Similarity to known drug target from sensitive sequence analysis

No drug targets

List of small molecules tested from TIBLE

Data not available

Off-target activity - ligand based from TIBLE

Data not available

Small molecules involved in protein-protein complex from TIMBAL .Proteins similar to Mtb based on sequence analysis.

Data not available

STITCH interactions

Chemical Name	Confidence score	Molecular Weight
streptomycinPubChem	0.819	581.574