SInCRe - Rv3922c

Tuberculist information

Gene name	Rv3922c
Protein function	Possible hemolysin
Functional category(tuberculist)	virulence,detoxification and adaptaion
Gene location(kb)	4410.05
Molecular mass(da)	13311.2
External sites	TB Database TubercuList WebTB

Protein sequence

Number of amino acids : 120

	  		  	1    VSLSRQSCGRVVRVTGRASARGLIFVIQVYRHMLSPLRPASCRFVPTCSQYAVDALTEYG   60
			  	61   LLRGSWLTMIRLAKCGPWHRGGWDPIPEGLTTGRSCQTDVDGANDDWNPASKRGERESFV  120

Known structures in the PDB

No Known structures

Number of amino acids : 120

Domains assigned based on sequence.

Mtb Structural proteome models

CHOPIN models

Profile-based domain assignment

Structural/Functional domain family	Pfam acc.no./SCOP ID	Domain Region
Haemolytic	PF01809	19-86

Mtb Structural Proteome models

Structure models not available for this query

Structure Models from Chopin

CHOPIN models not available for this query

Binding pockets

Structure models not available for this query

STRING

Cytoscape Web will replace the contents of this div with protein-protein interaction network.

Protein interacting with Rv3922c	Gene name	Confidence Score
Rv3921c	Rv3921c	0.975
Rv3923c	rnpA	0.967
Rv3924c	rpmH	0.951
Rv3920c	Rv3920c	0.922
Rv3920c	Rv3920c	0.922
Rv3919c	gid	0.902

Potential ligand/drug binding sites

No binding sites identified

Similarity to known drug target from sensitive sequence analysis

No drug targets

List of small molecules tested from TIBLE

Data not available

Off-target activity - ligand based from TIBLE

Data not available

Small molecules involved in protein-protein complex from TIMBAL .Proteins similar to Mtb based on sequence analysis.

Data not available

STITCH interactions

No high confidence interactions